Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M8850_RS02210 | Genome accession | NZ_CP097610 |
| Coordinates | 467816..468244 (-) | Length | 142 a.a. |
| NCBI ID | WP_250190612.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain 32985 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 445192..504087 | 467816..468244 | within | 0 |
Gene organization within MGE regions
Location: 445192..504087
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8850_RS02105 (M8850_02105) | - | 445192..446625 (-) | 1434 | WP_005754206.1 | glycosyltransferase family 2 protein | - |
| M8850_RS02110 (M8850_02110) | - | 446618..447790 (-) | 1173 | WP_005754204.1 | nucleotide sugar dehydrogenase | - |
| M8850_RS02115 (M8850_02115) | - | 447854..450772 (-) | 2919 | WP_005754202.1 | glycosyltransferase | - |
| M8850_RS02120 (M8850_02120) | - | 450789..452657 (-) | 1869 | WP_005754200.1 | hypothetical protein | - |
| M8850_RS02125 (M8850_02125) | - | 453039..455096 (+) | 2058 | WP_348524436.1 | capsular polysaccharide biosynthesis protein | - |
| M8850_RS02130 (M8850_02130) | - | 455106..456331 (+) | 1226 | Protein_402 | capsule biosynthesis protein | - |
| M8850_RS02135 (M8850_02135) | - | 456367..456819 (+) | 453 | WP_005716569.1 | DUF441 domain-containing protein | - |
| M8850_RS02140 (M8850_02140) | - | 456841..457224 (+) | 384 | WP_005754194.1 | DUF423 domain-containing protein | - |
| M8850_RS02145 (M8850_02145) | hrpA | 457224..461135 (+) | 3912 | WP_250190706.1 | ATP-dependent RNA helicase HrpA | - |
| M8850_RS02155 (M8850_02155) | - | 461839..463128 (+) | 1290 | WP_169326192.1 | integrase arm-type DNA-binding domain-containing protein | - |
| M8850_RS02160 (M8850_02160) | - | 463109..463285 (-) | 177 | WP_169326193.1 | helix-turn-helix domain-containing protein | - |
| M8850_RS02165 (M8850_02165) | - | 463500..463688 (-) | 189 | WP_238300505.1 | hypothetical protein | - |
| M8850_RS02170 (M8850_02170) | - | 463691..464134 (-) | 444 | WP_250190606.1 | pyruvate kinase | - |
| M8850_RS02175 (M8850_02175) | - | 464190..464774 (-) | 585 | WP_250190607.1 | DUF551 domain-containing protein | - |
| M8850_RS02180 (M8850_02180) | - | 464777..465262 (-) | 486 | WP_078737840.1 | methyltransferase | - |
| M8850_RS02185 (M8850_02185) | - | 465311..465526 (-) | 216 | WP_250190608.1 | hypothetical protein | - |
| M8850_RS02190 (M8850_02190) | - | 465618..465890 (-) | 273 | WP_250190609.1 | hypothetical protein | - |
| M8850_RS02195 (M8850_02195) | - | 465887..466486 (-) | 600 | WP_250190610.1 | hypothetical protein | - |
| M8850_RS02200 (M8850_02200) | - | 466541..467329 (-) | 789 | WP_250190611.1 | DUF2303 family protein | - |
| M8850_RS02205 (M8850_02205) | - | 467401..467754 (-) | 354 | WP_016570064.1 | hypothetical protein | - |
| M8850_RS02210 (M8850_02210) | ssb | 467816..468244 (-) | 429 | WP_250190612.1 | single-stranded DNA-binding protein | Machinery gene |
| M8850_RS02215 (M8850_02215) | - | 468245..468520 (-) | 276 | WP_250190613.1 | hypothetical protein | - |
| M8850_RS02220 (M8850_02220) | - | 469123..469665 (+) | 543 | WP_250190614.1 | hypothetical protein | - |
| M8850_RS02225 (M8850_02225) | - | 469797..469973 (-) | 177 | WP_169326206.1 | hypothetical protein | - |
| M8850_RS02230 (M8850_02230) | - | 470295..471245 (-) | 951 | WP_071171098.1 | hypothetical protein | - |
| M8850_RS02235 (M8850_02235) | - | 471351..472007 (-) | 657 | WP_223131937.1 | XRE family transcriptional regulator | - |
| M8850_RS02240 (M8850_02240) | - | 472137..472343 (+) | 207 | WP_223131938.1 | helix-turn-helix transcriptional regulator | - |
| M8850_RS02245 (M8850_02245) | - | 472392..472841 (+) | 450 | WP_250190615.1 | YmfL family putative regulatory protein | - |
| M8850_RS02250 (M8850_02250) | - | 472899..473651 (+) | 753 | WP_238300483.1 | Rha family transcriptional regulator | - |
| M8850_RS02255 (M8850_02255) | - | 473648..474718 (+) | 1071 | WP_250190616.1 | conserved phage C-terminal domain-containing protein | - |
| M8850_RS02260 (M8850_02260) | - | 474727..475260 (+) | 534 | WP_238300556.1 | phage N-6-adenine-methyltransferase | - |
| M8850_RS02265 (M8850_02265) | - | 475269..476246 (+) | 978 | WP_250190617.1 | DUF968 domain-containing protein | - |
| M8850_RS02270 (M8850_02270) | - | 476246..476620 (+) | 375 | WP_250190618.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M8850_RS02275 (M8850_02275) | - | 476607..476993 (+) | 387 | WP_167829995.1 | antiterminator Q family protein | - |
| M8850_RS02280 (M8850_02280) | - | 477146..477511 (+) | 366 | WP_238300477.1 | phage holin, lambda family | - |
| M8850_RS02285 (M8850_02285) | - | 477483..478067 (+) | 585 | WP_238300475.1 | glycoside hydrolase family 19 protein | - |
| M8850_RS02290 (M8850_02290) | - | 478070..478393 (+) | 324 | WP_238300473.1 | DUF2570 family protein | - |
| M8850_RS02295 (M8850_02295) | - | 478605..478973 (-) | 369 | WP_014391478.1 | helix-turn-helix transcriptional regulator | - |
| M8850_RS02300 (M8850_02300) | - | 479010..479270 (-) | 261 | WP_005720780.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M8850_RS02305 (M8850_02305) | - | 479561..480025 (+) | 465 | WP_250190619.1 | DUF1441 family protein | - |
| M8850_RS02310 (M8850_02310) | - | 480040..482148 (+) | 2109 | WP_250190620.1 | phage terminase large subunit family protein | - |
| M8850_RS02315 (M8850_02315) | - | 482145..482366 (+) | 222 | WP_014391481.1 | hypothetical protein | - |
| M8850_RS02320 (M8850_02320) | - | 482363..483898 (+) | 1536 | WP_250190621.1 | phage portal protein | - |
| M8850_RS02325 (M8850_02325) | - | 483834..485843 (+) | 2010 | WP_250190622.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| M8850_RS02330 (M8850_02330) | - | 485913..486239 (+) | 327 | WP_016570083.1 | capsid cement protein | - |
| M8850_RS02335 (M8850_02335) | - | 486232..486525 (+) | 294 | WP_014391484.1 | hypothetical protein | - |
| M8850_RS02340 (M8850_02340) | - | 486525..487076 (+) | 552 | WP_250190623.1 | phage tail protein | - |
| M8850_RS02345 (M8850_02345) | gpU | 487073..487480 (+) | 408 | WP_115098330.1 | phage tail terminator protein | - |
| M8850_RS02350 (M8850_02350) | - | 487477..487986 (+) | 510 | WP_046339069.1 | phage tail tube protein | - |
| M8850_RS02355 (M8850_02355) | - | 487989..488378 (+) | 390 | WP_250190624.1 | phage minor tail protein G | - |
| M8850_RS02360 (M8850_02360) | - | 488399..488701 (+) | 303 | WP_258553973.1 | phage tail assembly protein T | - |
| M8850_RS02365 (M8850_02365) | - | 488688..491084 (+) | 2397 | WP_250190625.1 | phage tail length tape measure family protein | - |
| M8850_RS02370 (M8850_02370) | - | 491084..491431 (+) | 348 | WP_115098326.1 | phage tail protein | - |
| M8850_RS02375 (M8850_02375) | - | 491506..492060 (+) | 555 | WP_250190626.1 | UDP-N-acetylglucosamine acyltransferase | - |
| M8850_RS02380 (M8850_02380) | - | 492109..492759 (+) | 651 | WP_250190627.1 | phage minor tail protein L | - |
| M8850_RS02385 (M8850_02385) | - | 492761..493474 (+) | 714 | WP_250190628.1 | C40 family peptidase | - |
| M8850_RS02390 (M8850_02390) | - | 493407..494132 (+) | 726 | WP_250190629.1 | tail assembly protein | - |
| M8850_RS02395 (M8850_02395) | - | 494136..497783 (+) | 3648 | WP_250190630.1 | phage tail protein | - |
| M8850_RS02400 (M8850_02400) | - | 497797..499500 (+) | 1704 | WP_250190631.1 | pyocin knob domain-containing protein | - |
| M8850_RS02405 (M8850_02405) | - | 499511..500098 (+) | 588 | WP_250190632.1 | DUF4376 domain-containing protein | - |
| M8850_RS02410 (M8850_02410) | - | 500088..500345 (+) | 258 | WP_250190633.1 | DNA helicase UvrD | - |
| M8850_RS02415 (M8850_02415) | - | 500378..500737 (-) | 360 | WP_250190634.1 | hypothetical protein | - |
| M8850_RS02420 (M8850_02420) | - | 500790..501473 (-) | 684 | WP_250190635.1 | hypothetical protein | - |
| M8850_RS02425 (M8850_02425) | - | 501534..501731 (-) | 198 | WP_005725436.1 | ribbon-helix-helix protein, CopG family | - |
| M8850_RS02430 (M8850_02430) | - | 501728..502363 (-) | 636 | WP_250190636.1 | DNA methyltransferase | - |
| M8850_RS02435 (M8850_02435) | - | 502360..504087 (-) | 1728 | WP_250190637.1 | DEAD/DEAH box helicase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15922.85 Da Isoelectric Point: 6.7216
>NTDB_id=691190 M8850_RS02210 WP_250190612.1 467816..468244(-) (ssb) [Pasteurella multocida strain 32985]
MAGVNKVIIVGNLGQDPDHKVMTNGDPVTNISVATSEVWADKASGEKREVVEWHRITLYRRQADIAAQFLKKGSKVYIEG
RLRTRKWQDQSGQERYITEILADKIVLLDSKQTAGTGNSNPPPEQQQHDPYGDAFNCDNIPF
MAGVNKVIIVGNLGQDPDHKVMTNGDPVTNISVATSEVWADKASGEKREVVEWHRITLYRRQADIAAQFLKKGSKVYIEG
RLRTRKWQDQSGQERYITEILADKIVLLDSKQTAGTGNSNPPPEQQQHDPYGDAFNCDNIPF
Nucleotide
Download Length: 429 bp
>NTDB_id=691190 M8850_RS02210 WP_250190612.1 467816..468244(-) (ssb) [Pasteurella multocida strain 32985]
ATGGCTGGAGTAAATAAAGTAATTATTGTTGGCAACTTAGGACAAGACCCAGATCACAAAGTAATGACAAATGGCGATCC
CGTGACCAATATCAGCGTGGCCACAAGTGAAGTGTGGGCTGATAAAGCAAGCGGTGAAAAACGCGAAGTTGTCGAATGGC
ACCGTATTACGCTATATCGACGACAAGCAGACATTGCCGCGCAGTTTTTGAAAAAAGGCTCAAAAGTTTATATTGAAGGT
CGTTTGCGAACTCGAAAATGGCAAGATCAAAGCGGACAAGAACGATACATCACGGAAATTCTCGCTGATAAGATCGTCTT
ACTTGATAGCAAGCAGACTGCAGGCACTGGCAATAGCAATCCACCACCGGAACAACAGCAACATGATCCGTATGGTGATG
CATTTAATTGTGACAATATTCCATTCTGA
ATGGCTGGAGTAAATAAAGTAATTATTGTTGGCAACTTAGGACAAGACCCAGATCACAAAGTAATGACAAATGGCGATCC
CGTGACCAATATCAGCGTGGCCACAAGTGAAGTGTGGGCTGATAAAGCAAGCGGTGAAAAACGCGAAGTTGTCGAATGGC
ACCGTATTACGCTATATCGACGACAAGCAGACATTGCCGCGCAGTTTTTGAAAAAAGGCTCAAAAGTTTATATTGAAGGT
CGTTTGCGAACTCGAAAATGGCAAGATCAAAGCGGACAAGAACGATACATCACGGAAATTCTCGCTGATAAGATCGTCTT
ACTTGATAGCAAGCAGACTGCAGGCACTGGCAATAGCAATCCACCACCGGAACAACAGCAACATGATCCGTATGGTGATG
CATTTAATTGTGACAATATTCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
66.087 |
80.986 |
0.535 |
| ssb | Neisseria meningitidis MC58 |
43.662 |
100 |
0.437 |
| ssb | Vibrio cholerae strain A1552 |
62.626 |
69.718 |
0.437 |
| ssb | Neisseria gonorrhoeae MS11 |
47.368 |
80.282 |
0.38 |