Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   M8X21_RS12410 Genome accession   NZ_CP097467
Coordinates   2546792..2547106 (-) Length   104 a.a.
NCBI ID   WP_029973875.1    Uniprot ID   -
Organism   Bacillus velezensis strain HMB26553     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2541792..2552106
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8X21_RS12365 (M8X21_12365) sinI 2542473..2542646 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  M8X21_RS12370 (M8X21_12370) sinR 2542680..2543015 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8X21_RS12375 (M8X21_12375) - 2543063..2543848 (-) 786 WP_007408329.1 TasA family protein -
  M8X21_RS12380 (M8X21_12380) - 2543913..2544497 (-) 585 WP_012117977.1 signal peptidase I -
  M8X21_RS12385 (M8X21_12385) tapA 2544469..2545140 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  M8X21_RS12390 (M8X21_12390) - 2545399..2545728 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  M8X21_RS12395 (M8X21_12395) - 2545769..2545948 (-) 180 WP_003153093.1 YqzE family protein -
  M8X21_RS12400 (M8X21_12400) comGG 2546005..2546382 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8X21_RS12405 (M8X21_12405) comGF 2546383..2546847 (-) 465 WP_233717055.1 competence type IV pilus minor pilin ComGF -
  M8X21_RS12410 (M8X21_12410) comGE 2546792..2547106 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  M8X21_RS12415 (M8X21_12415) comGD 2547090..2547527 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8X21_RS12420 (M8X21_12420) comGC 2547517..2547825 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  M8X21_RS12425 (M8X21_12425) comGB 2547830..2548867 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  M8X21_RS12430 (M8X21_12430) comGA 2548854..2549924 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  M8X21_RS12435 (M8X21_12435) - 2550117..2551067 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11862.88 Da        Isoelectric Point: 6.9470

>NTDB_id=689635 M8X21_RS12410 WP_029973875.1 2546792..2547106(-) (comGE) [Bacillus velezensis strain HMB26553]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=689635 M8X21_RS12410 WP_029973875.1 2546792..2547106(-) (comGE) [Bacillus velezensis strain HMB26553]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49