Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M8X21_RS12365 Genome accession   NZ_CP097467
Coordinates   2542473..2542646 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain HMB26553     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2537473..2547646
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8X21_RS12350 (M8X21_12350) gcvT 2538286..2539386 (-) 1101 WP_029973877.1 glycine cleavage system aminomethyltransferase GcvT -
  M8X21_RS12355 (M8X21_12355) - 2539810..2541480 (+) 1671 WP_021494309.1 SNF2-related protein -
  M8X21_RS12360 (M8X21_12360) - 2541502..2542296 (+) 795 WP_014418368.1 YqhG family protein -
  M8X21_RS12365 (M8X21_12365) sinI 2542473..2542646 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  M8X21_RS12370 (M8X21_12370) sinR 2542680..2543015 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8X21_RS12375 (M8X21_12375) - 2543063..2543848 (-) 786 WP_007408329.1 TasA family protein -
  M8X21_RS12380 (M8X21_12380) - 2543913..2544497 (-) 585 WP_012117977.1 signal peptidase I -
  M8X21_RS12385 (M8X21_12385) tapA 2544469..2545140 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  M8X21_RS12390 (M8X21_12390) - 2545399..2545728 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  M8X21_RS12395 (M8X21_12395) - 2545769..2545948 (-) 180 WP_003153093.1 YqzE family protein -
  M8X21_RS12400 (M8X21_12400) comGG 2546005..2546382 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8X21_RS12405 (M8X21_12405) comGF 2546383..2546847 (-) 465 WP_233717055.1 competence type IV pilus minor pilin ComGF -
  M8X21_RS12410 (M8X21_12410) comGE 2546792..2547106 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  M8X21_RS12415 (M8X21_12415) comGD 2547090..2547527 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=689632 M8X21_RS12365 WP_014418369.1 2542473..2542646(+) (sinI) [Bacillus velezensis strain HMB26553]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=689632 M8X21_RS12365 WP_014418369.1 2542473..2542646(+) (sinI) [Bacillus velezensis strain HMB26553]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719