Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   M2M89_RS12155 Genome accession   NZ_CP097130
Coordinates   2394963..2395337 (-) Length   124 a.a.
NCBI ID   WP_032726157.1    Uniprot ID   A0AAP2PZF3
Organism   Bacillus subtilis strain S16     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2389963..2400337
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M2M89_RS12115 yqhG 2390293..2391087 (+) 795 WP_249385575.1 YqhG family protein -
  M2M89_RS12120 sinI 2391271..2391444 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  M2M89_RS12125 sinR 2391478..2391813 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  M2M89_RS12130 tasA 2391905..2392690 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  M2M89_RS12135 sipW 2392755..2393327 (-) 573 WP_077671469.1 signal peptidase I SipW -
  M2M89_RS12140 tapA 2393311..2394072 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  M2M89_RS12145 yqzG 2394344..2394670 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  M2M89_RS12150 spoIIT 2394712..2394891 (-) 180 WP_014480252.1 YqzE family protein -
  M2M89_RS12155 comGG 2394963..2395337 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  M2M89_RS12160 comGF 2395338..2395721 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  M2M89_RS12165 comGE 2395747..2396094 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  M2M89_RS12170 comGD 2396078..2396509 (-) 432 WP_038829732.1 comG operon protein ComGD Machinery gene
  M2M89_RS12175 comGC 2396499..2396795 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  M2M89_RS12180 comGB 2396809..2397846 (-) 1038 WP_077671432.1 comG operon protein ComGB Machinery gene
  M2M89_RS12185 comGA 2397833..2398903 (-) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  M2M89_RS12190 - 2399131..2399313 (-) 183 WP_033884706.1 hypothetical protein -
  M2M89_RS12195 corA 2399315..2400268 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14510.75 Da        Isoelectric Point: 9.7778

>NTDB_id=687434 M2M89_RS12155 WP_032726157.1 2394963..2395337(-) (comGG) [Bacillus subtilis strain S16]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEKRKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=687434 M2M89_RS12155 WP_032726157.1 2394963..2395337(-) (comGG) [Bacillus subtilis strain S16]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCACGTTCTAGAGAAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAGCAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.968

100

0.96