Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M2M89_RS12120 Genome accession   NZ_CP097130
Coordinates   2391271..2391444 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain S16     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2386271..2396444
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M2M89_RS12105 gcvT 2387069..2388157 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  M2M89_RS12110 yqhH 2388599..2390272 (+) 1674 WP_038829735.1 SNF2-related protein -
  M2M89_RS12115 yqhG 2390293..2391087 (+) 795 WP_249385575.1 YqhG family protein -
  M2M89_RS12120 sinI 2391271..2391444 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  M2M89_RS12125 sinR 2391478..2391813 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  M2M89_RS12130 tasA 2391905..2392690 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  M2M89_RS12135 sipW 2392755..2393327 (-) 573 WP_077671469.1 signal peptidase I SipW -
  M2M89_RS12140 tapA 2393311..2394072 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  M2M89_RS12145 yqzG 2394344..2394670 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  M2M89_RS12150 spoIIT 2394712..2394891 (-) 180 WP_014480252.1 YqzE family protein -
  M2M89_RS12155 comGG 2394963..2395337 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  M2M89_RS12160 comGF 2395338..2395721 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  M2M89_RS12165 comGE 2395747..2396094 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=687432 M2M89_RS12120 WP_014477323.1 2391271..2391444(+) (sinI) [Bacillus subtilis strain S16]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=687432 M2M89_RS12120 WP_014477323.1 2391271..2391444(+) (sinI) [Bacillus subtilis strain S16]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982