Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   M1Y13_RS22315 Genome accession   NZ_CP096902
Coordinates   4544788..4545324 (-) Length   178 a.a.
NCBI ID   WP_000168305.1    Uniprot ID   A0A9P2PPK2
Organism   Escherichia coli strain RSHH22     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4542887..4592589 4544788..4545324 within 0


Gene organization within MGE regions


Location: 4542887..4592589
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M1Y13_RS22310 (M1Y13_22315) ltrA 4542887..4544224 (-) 1338 WP_115425395.1 group II intron reverse transcriptase/maturase -
  M1Y13_RS22315 (M1Y13_22320) ssb 4544788..4545324 (-) 537 WP_000168305.1 single-stranded DNA-binding protein SSB1 Machinery gene
  M1Y13_RS22320 (M1Y13_22325) uvrA 4545578..4548400 (+) 2823 WP_000357740.1 excinuclease ABC subunit UvrA -
  M1Y13_RS22325 (M1Y13_22330) yjbR 4548435..4548791 (-) 357 WP_000155657.1 MmcQ/YjbR family DNA-binding protein -
  M1Y13_RS22330 (M1Y13_22335) yjbQ 4548795..4549211 (-) 417 WP_000270372.1 secondary thiamine-phosphate synthase enzyme YjbQ -
  M1Y13_RS22335 (M1Y13_22340) aphA 4549322..4550035 (-) 714 WP_001315956.1 acid phosphatase AphA -
  M1Y13_RS22340 (M1Y13_22345) - 4550437..4550659 (+) 223 Protein_4391 hypothetical protein -
  M1Y13_RS22345 (M1Y13_22350) - 4550689..4550940 (+) 252 WP_000275035.1 hypothetical protein -
  M1Y13_RS22350 (M1Y13_22355) tyrB 4551162..4552355 (-) 1194 WP_000486997.1 aromatic amino acid transaminase -
  M1Y13_RS22355 (M1Y13_22360) alr 4552608..4553687 (-) 1080 WP_001147328.1 alanine racemase -
  M1Y13_RS22360 (M1Y13_22365) dnaB 4553740..4555155 (-) 1416 WP_000918363.1 replicative DNA helicase -
  M1Y13_RS22365 (M1Y13_22370) qorA 4555238..4556221 (+) 984 WP_000235518.1 quinone oxidoreductase -
  M1Y13_RS22370 (M1Y13_22375) pspG 4556387..4556629 (-) 243 WP_000891389.1 envelope stress response protein PspG -
  M1Y13_RS22375 (M1Y13_22380) dusA 4556763..4557800 (-) 1038 WP_000543841.1 tRNA dihydrouridine(20/20a) synthase DusA -
  M1Y13_RS22380 (M1Y13_22385) - 4557889..4558986 (+) 1098 WP_000332262.1 site-specific integrase -
  M1Y13_RS22385 (M1Y13_22390) - 4559048..4559296 (+) 249 WP_001217553.1 DinI-like family protein -
  M1Y13_RS22390 (M1Y13_22395) - 4559293..4559415 (-) 123 WP_001437322.1 hypothetical protein -
  M1Y13_RS22395 (M1Y13_22400) - 4559440..4560003 (-) 564 WP_000639149.1 recombinase family protein -
  M1Y13_RS22400 (M1Y13_22405) - 4560134..4560409 (+) 276 WP_248699739.1 hypothetical protein -
  M1Y13_RS22405 (M1Y13_22410) - 4560409..4560852 (+) 444 WP_000978829.1 tail fiber assembly protein -
  M1Y13_RS22410 (M1Y13_22415) - 4560824..4561432 (-) 609 WP_016240347.1 tail fiber assembly protein -
  M1Y13_RS22415 (M1Y13_22420) - 4561432..4562190 (-) 759 WP_242386840.1 phage tail protein -
  M1Y13_RS22420 (M1Y13_22425) ymfQ 4562194..4562778 (-) 585 WP_000383548.1 YmfQ family protein -
  M1Y13_RS22425 (M1Y13_22430) - 4562769..4563827 (-) 1059 WP_021527505.1 baseplate J/gp47 family protein -
  M1Y13_RS22430 (M1Y13_22435) - 4563814..4564239 (-) 426 WP_000424737.1 phage GP46 family protein -
  M1Y13_RS22435 (M1Y13_22440) - 4564239..4564787 (-) 549 WP_129542061.1 phage baseplate assembly protein V -
  M1Y13_RS22440 (M1Y13_22445) - 4564787..4565866 (-) 1080 WP_000999510.1 phage baseplate assembly protein -
  M1Y13_RS22445 (M1Y13_22450) - 4565863..4567191 (-) 1329 WP_021546512.1 DNA circularization N-terminal domain-containing protein -
  M1Y13_RS22450 (M1Y13_22455) - 4567282..4567776 (-) 495 WP_001219112.1 hypothetical protein -
  M1Y13_RS22455 (M1Y13_22460) - 4567876..4569708 (-) 1833 WP_129542060.1 phage tail tape measure protein -
  M1Y13_RS22460 (M1Y13_22465) - 4569850..4570119 (-) 270 WP_000661050.1 phage tail assembly protein -
  M1Y13_RS22465 (M1Y13_22470) - 4570119..4570475 (-) 357 WP_129542059.1 phage tail tube protein -
  M1Y13_RS22470 (M1Y13_22475) - 4570475..4571971 (-) 1497 WP_129542058.1 phage tail sheath subtilisin-like domain-containing protein -
  M1Y13_RS22475 (M1Y13_22480) - 4571955..4572125 (-) 171 WP_000497750.1 DUF2635 domain-containing protein -
  M1Y13_RS22480 (M1Y13_22485) - 4572134..4572694 (-) 561 WP_021546509.1 hypothetical protein -
  M1Y13_RS22485 (M1Y13_22490) - 4572691..4573197 (-) 507 WP_021546508.1 hypothetical protein -
  M1Y13_RS22490 (M1Y13_22495) - 4573172..4573582 (-) 411 WP_000702395.1 phage head closure protein -
  M1Y13_RS22495 (M1Y13_22500) - 4573579..4573902 (-) 324 WP_000924830.1 head-tail connector protein -
  M1Y13_RS22500 (M1Y13_22505) - 4573980..4575209 (-) 1230 WP_000766098.1 phage major capsid protein -
  M1Y13_RS22505 (M1Y13_22510) - 4575220..4575822 (-) 603 WP_000999805.1 HK97 family phage prohead protease -
  M1Y13_RS22510 (M1Y13_22515) - 4575815..4577041 (-) 1227 WP_000923135.1 phage portal protein -
  M1Y13_RS22515 (M1Y13_22520) - 4577031..4577192 (-) 162 WP_021546507.1 hypothetical protein -
  M1Y13_RS22520 (M1Y13_22525) - 4577189..4578922 (-) 1734 WP_000088162.1 terminase large subunit -
  M1Y13_RS22525 (M1Y13_22530) - 4578936..4579421 (-) 486 WP_021546506.1 phage terminase small subunit P27 family -
  M1Y13_RS22530 (M1Y13_22535) - 4579547..4579897 (-) 351 WP_001135203.1 HNH endonuclease signature motif containing protein -
  M1Y13_RS22535 (M1Y13_22540) - 4579990..4580310 (-) 321 WP_000651450.1 GrlR family regulatory protein -
  M1Y13_RS22540 (M1Y13_22545) - 4580557..4580949 (-) 393 WP_123007916.1 DUF2570 domain-containing protein -
  M1Y13_RS22545 (M1Y13_22550) - 4580946..4581560 (-) 615 WP_001542445.1 glycoside hydrolase family 19 protein -
  M1Y13_RS22550 (M1Y13_22555) - 4581560..4581841 (-) 282 WP_000422366.1 phage holin family protein -
  M1Y13_RS22555 (M1Y13_22560) - 4581828..4582214 (-) 387 WP_001283169.1 phage holin family protein -
  M1Y13_RS22560 (M1Y13_22565) - 4582294..4582551 (-) 258 WP_001542448.1 hypothetical protein -
  M1Y13_RS22565 (M1Y13_22570) - 4582702..4583454 (-) 753 WP_032175905.1 antitermination protein -
  M1Y13_RS22570 (M1Y13_22575) - 4583468..4584457 (-) 990 WP_001433852.1 DUF968 domain-containing protein -
  M1Y13_RS22575 (M1Y13_22580) - 4584465..4585274 (-) 810 WP_001061380.1 KilA-N domain-containing protein -
  M1Y13_RS22580 (M1Y13_22585) - 4585294..4585683 (-) 390 WP_000767118.1 RusA family crossover junction endodeoxyribonuclease -
  M1Y13_RS22585 (M1Y13_22590) - 4585680..4586006 (-) 327 WP_129542057.1 LexA family transcriptional regulator -
  M1Y13_RS22590 (M1Y13_22595) - 4586003..4586518 (-) 516 Protein_4441 phage N-6-adenine-methyltransferase -
  M1Y13_RS22595 (M1Y13_22600) - 4586589..4588208 (+) 1620 WP_075262665.1 ISL3-like element ISEc38 family transposase -
  M1Y13_RS22600 (M1Y13_22605) - 4588259..4588426 (+) 168 Protein_4443 putative zinc ribbon protein -
  M1Y13_RS22605 (M1Y13_22610) - 4588929..4590542 (-) 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
  M1Y13_RS22610 (M1Y13_22615) tnpB 4590573..4590923 (-) 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
  M1Y13_RS22615 (M1Y13_22620) - 4590920..4591345 (-) 426 WP_000422741.1 transposase -
  M1Y13_RS22620 (M1Y13_22625) - 4591597..4592004 (+) 408 WP_085458388.1 inovirus-type Gp2 protein -
  M1Y13_RS22625 (M1Y13_22630) - 4592054..4592324 (+) 271 Protein_4448 hypothetical protein -
  M1Y13_RS22630 (M1Y13_22635) - 4592392..4592589 (+) 198 WP_001305346.1 AlpA family transcriptional regulator -

Sequence

Protein


Download         Length: 178 a.a.        Molecular weight: 18975.00 Da        Isoelectric Point: 5.2358

>NTDB_id=684996 M1Y13_RS22315 WP_000168305.1 4544788..4545324(-) (ssb) [Escherichia coli strain RSHH22]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF

Nucleotide


Download         Length: 537 bp        

>NTDB_id=684996 M1Y13_RS22315 WP_000168305.1 4544788..4545324(-) (ssb) [Escherichia coli strain RSHH22]
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAACAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCGAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC
GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACAGAAGTCGTGGTGAACGTTGG
CGGCACCATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCGGCAGGTGGCAATATCGGTGGTGGTCAGCCGCAGG
GCGGTTGGGGTCAGCCACAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

74.444

100

0.753
  ssb Glaesserella parasuis strain SC1401

57.923

100

0.596
  ssb Neisseria meningitidis MC58

48.066

100

0.489
  ssb Neisseria gonorrhoeae MS11

48.066

100

0.489