Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   EFK13_RS12540 Genome accession   NZ_CP096889
Coordinates   2472983..2473357 (-) Length   124 a.a.
NCBI ID   WP_129505178.1    Uniprot ID   -
Organism   Bacillus cabrialesii strain TE3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2467983..2478357
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EFK13_RS12500 (EFK13_12500) - 2468308..2469102 (+) 795 WP_129505184.1 YqhG family protein -
  EFK13_RS12505 (EFK13_12505) sinI 2469288..2469461 (+) 174 WP_064814194.1 anti-repressor SinI family protein Regulator
  EFK13_RS12510 (EFK13_12510) sinR 2469495..2469830 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EFK13_RS12515 (EFK13_12515) tasA 2469924..2470709 (-) 786 WP_129505183.1 biofilm matrix protein TasA -
  EFK13_RS12520 (EFK13_12520) - 2470773..2471345 (-) 573 WP_129505182.1 signal peptidase I -
  EFK13_RS12525 (EFK13_12525) tapA 2471329..2472090 (-) 762 WP_129505181.1 amyloid fiber anchoring/assembly protein TapA -
  EFK13_RS12530 (EFK13_12530) - 2472364..2472690 (+) 327 WP_129505180.1 YqzG/YhdC family protein -
  EFK13_RS12535 (EFK13_12535) - 2472732..2472911 (-) 180 WP_129505179.1 YqzE family protein -
  EFK13_RS12540 (EFK13_12540) comGG 2472983..2473357 (-) 375 WP_129505178.1 competence type IV pilus minor pilin ComGG Machinery gene
  EFK13_RS12545 (EFK13_12545) comGF 2473358..2473741 (-) 384 WP_129505177.1 competence type IV pilus minor pilin ComGF Machinery gene
  EFK13_RS12550 (EFK13_12550) comGE 2473767..2474114 (-) 348 WP_129505176.1 competence type IV pilus minor pilin ComGE Machinery gene
  EFK13_RS12555 (EFK13_12555) comGD 2474098..2474529 (-) 432 WP_129505175.1 competence type IV pilus minor pilin ComGD Machinery gene
  EFK13_RS12560 (EFK13_12560) comGC 2474519..2474815 (-) 297 WP_129505174.1 comG operon protein ComGC Machinery gene
  EFK13_RS12565 (EFK13_12565) comGB 2474829..2475866 (-) 1038 WP_129505173.1 competence type IV pilus assembly protein ComGB Machinery gene
  EFK13_RS12570 (EFK13_12570) comGA 2475853..2476923 (-) 1071 WP_129505172.1 competence protein ComGA Machinery gene
  EFK13_RS12575 (EFK13_12575) - 2477137..2477547 (-) 411 WP_129505171.1 CBS domain-containing protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14311.44 Da        Isoelectric Point: 9.8245

>NTDB_id=684880 EFK13_RS12540 WP_129505178.1 2472983..2473357(-) (comGG) [Bacillus cabrialesii strain TE3]
MYRTKGFIYPAVLFVSALVLLIVNFTAAQYVSRCLFEKETKEFYTGENLLQNGALLSIRHVLEQRKGQKGSQQFAYGQVS
YRIHDTSIKEQKEISLQARTESGIERTAQVVFDQKQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=684880 EFK13_RS12540 WP_129505178.1 2472983..2473357(-) (comGG) [Bacillus cabrialesii strain TE3]
ATGTACCGCACGAAAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCCGCGCTTGTGCTGCTGATTGTGAATTTTACTGC
TGCTCAATATGTTTCACGCTGCTTGTTTGAAAAGGAAACAAAAGAGTTTTACACAGGTGAGAATTTGCTTCAAAATGGCG
CGCTTCTGTCTATTCGGCATGTTCTTGAGCAGAGGAAAGGACAAAAGGGTTCACAGCAGTTTGCATATGGGCAGGTTTCT
TATCGCATTCACGATACGTCGATAAAAGAGCAAAAAGAAATCAGCTTACAAGCAAGGACGGAGTCTGGAATAGAAAGAAC
TGCACAGGTCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGCTGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

83.065

100

0.831