Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   EFK13_RS12505 Genome accession   NZ_CP096889
Coordinates   2469288..2469461 (+) Length   57 a.a.
NCBI ID   WP_064814194.1    Uniprot ID   -
Organism   Bacillus cabrialesii strain TE3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2464288..2474461
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EFK13_RS12490 (EFK13_12490) gcvT 2465083..2466171 (-) 1089 WP_129505186.1 glycine cleavage system aminomethyltransferase GcvT -
  EFK13_RS12495 (EFK13_12495) - 2466614..2468287 (+) 1674 WP_129505185.1 SNF2-related protein -
  EFK13_RS12500 (EFK13_12500) - 2468308..2469102 (+) 795 WP_129505184.1 YqhG family protein -
  EFK13_RS12505 (EFK13_12505) sinI 2469288..2469461 (+) 174 WP_064814194.1 anti-repressor SinI family protein Regulator
  EFK13_RS12510 (EFK13_12510) sinR 2469495..2469830 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EFK13_RS12515 (EFK13_12515) tasA 2469924..2470709 (-) 786 WP_129505183.1 biofilm matrix protein TasA -
  EFK13_RS12520 (EFK13_12520) - 2470773..2471345 (-) 573 WP_129505182.1 signal peptidase I -
  EFK13_RS12525 (EFK13_12525) tapA 2471329..2472090 (-) 762 WP_129505181.1 amyloid fiber anchoring/assembly protein TapA -
  EFK13_RS12530 (EFK13_12530) - 2472364..2472690 (+) 327 WP_129505180.1 YqzG/YhdC family protein -
  EFK13_RS12535 (EFK13_12535) - 2472732..2472911 (-) 180 WP_129505179.1 YqzE family protein -
  EFK13_RS12540 (EFK13_12540) comGG 2472983..2473357 (-) 375 WP_129505178.1 competence type IV pilus minor pilin ComGG Machinery gene
  EFK13_RS12545 (EFK13_12545) comGF 2473358..2473741 (-) 384 WP_129505177.1 competence type IV pilus minor pilin ComGF Machinery gene
  EFK13_RS12550 (EFK13_12550) comGE 2473767..2474114 (-) 348 WP_129505176.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6662.66 Da        Isoelectric Point: 8.6596

>NTDB_id=684878 EFK13_RS12505 WP_064814194.1 2469288..2469461(+) (sinI) [Bacillus cabrialesii strain TE3]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPATRSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=684878 EFK13_RS12505 WP_064814194.1 2469288..2469461(+) (sinI) [Bacillus cabrialesii strain TE3]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCGAATAT
CAGCCCTGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAACCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

94.737

100

0.947