Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M1S35_RS02695 | Genome accession | NZ_CP096766 |
| Coordinates | 546923..547276 (-) | Length | 117 a.a. |
| NCBI ID | WP_001214081.1 | Uniprot ID | - |
| Organism | Acinetobacter baumannii strain 5626 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 544558..577707 | 546923..547276 | within | 0 |
Gene organization within MGE regions
Location: 544558..577707
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1S35_RS02675 (M1S35_02675) | - | 544558..545625 (+) | 1068 | WP_000107856.1 | site-specific integrase | - |
| M1S35_RS02680 (M1S35_02680) | - | 545653..545949 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| M1S35_RS02685 (M1S35_02685) | - | 545946..546167 (-) | 222 | WP_000424583.1 | hypothetical protein | - |
| M1S35_RS02690 (M1S35_02690) | - | 546176..546913 (-) | 738 | WP_000125746.1 | 3'-5' exonuclease | - |
| M1S35_RS02695 (M1S35_02695) | ssb | 546923..547276 (-) | 354 | WP_001214081.1 | single-stranded DNA-binding protein | Machinery gene |
| M1S35_RS02700 (M1S35_02700) | - | 547264..547581 (-) | 318 | WP_000049862.1 | hypothetical protein | - |
| M1S35_RS02705 (M1S35_02705) | - | 547585..548103 (-) | 519 | WP_000877796.1 | hypothetical protein | - |
| M1S35_RS02710 (M1S35_02710) | - | 548106..548537 (-) | 432 | WP_001178667.1 | DUF2528 family protein | - |
| M1S35_RS02715 (M1S35_02715) | - | 548605..548940 (-) | 336 | WP_000841657.1 | hypothetical protein | - |
| M1S35_RS02720 (M1S35_02720) | - | 548937..551675 (-) | 2739 | WP_025464780.1 | toprim domain-containing protein | - |
| M1S35_RS02725 (M1S35_02725) | - | 551769..551960 (-) | 192 | WP_001043481.1 | hypothetical protein | - |
| M1S35_RS02730 (M1S35_02730) | - | 552053..552394 (+) | 342 | WP_000786717.1 | helix-turn-helix transcriptional regulator | - |
| M1S35_RS02735 (M1S35_02735) | - | 552439..552654 (-) | 216 | WP_000556347.1 | hypothetical protein | - |
| M1S35_RS02740 (M1S35_02740) | - | 552755..553000 (-) | 246 | WP_000789360.1 | hypothetical protein | - |
| M1S35_RS02745 (M1S35_02745) | - | 553003..553197 (-) | 195 | WP_002001330.1 | hypothetical protein | - |
| M1S35_RS02750 (M1S35_02750) | - | 553517..553840 (-) | 324 | WP_000720885.1 | DUF2511 domain-containing protein | - |
| M1S35_RS02755 (M1S35_02755) | - | 553920..554561 (+) | 642 | WP_000332608.1 | SOS response-associated peptidase family protein | - |
| M1S35_RS02760 (M1S35_02760) | umuD | 554674..555174 (+) | 501 | WP_000072259.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| M1S35_RS02765 (M1S35_02765) | - | 555171..556466 (+) | 1296 | WP_000679982.1 | Y-family DNA polymerase | - |
| M1S35_RS02770 (M1S35_02770) | - | 556756..556956 (-) | 201 | WP_000130086.1 | TraR/DksA C4-type zinc finger protein | - |
| M1S35_RS02775 (M1S35_02775) | - | 556953..557192 (-) | 240 | WP_000113727.1 | ogr/Delta-like zinc finger family protein | - |
| M1S35_RS02780 (M1S35_02780) | - | 557321..558634 (-) | 1314 | WP_000483168.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| M1S35_RS02785 (M1S35_02785) | - | 558635..559075 (-) | 441 | WP_000979754.1 | phage tail protein | - |
| M1S35_RS02790 (M1S35_02790) | - | 559081..561531 (-) | 2451 | WP_000774269.1 | phage tail tape measure protein | - |
| M1S35_RS20305 | - | 561545..561658 (-) | 114 | WP_074166825.1 | GpE family phage tail protein | - |
| M1S35_RS02795 (M1S35_02795) | - | 561685..562026 (-) | 342 | WP_001071616.1 | phage tail assembly protein | - |
| M1S35_RS02800 (M1S35_02800) | - | 562093..562611 (-) | 519 | WP_001207609.1 | phage major tail tube protein | - |
| M1S35_RS02805 (M1S35_02805) | - | 562624..563799 (-) | 1176 | WP_000963363.1 | phage tail sheath protein | - |
| M1S35_RS02810 (M1S35_02810) | - | 563899..564126 (-) | 228 | WP_001279430.1 | hypothetical protein | - |
| M1S35_RS02815 (M1S35_02815) | - | 564128..566374 (-) | 2247 | WP_000729644.1 | phage tail protein | - |
| M1S35_RS02820 (M1S35_02820) | - | 566386..566991 (-) | 606 | WP_001050806.1 | phage tail protein I | - |
| M1S35_RS02825 (M1S35_02825) | - | 566991..567893 (-) | 903 | WP_000109741.1 | baseplate J/gp47 family protein | - |
| M1S35_RS02830 (M1S35_02830) | - | 567890..568237 (-) | 348 | WP_000987743.1 | GPW/gp25 family protein | - |
| M1S35_RS02835 (M1S35_02835) | - | 568234..568917 (-) | 684 | WP_000990627.1 | phage baseplate assembly protein V | - |
| M1S35_RS02840 (M1S35_02840) | - | 568990..569439 (-) | 450 | WP_001059840.1 | phage virion morphogenesis protein | - |
| M1S35_RS02845 (M1S35_02845) | - | 569436..569963 (-) | 528 | WP_000742887.1 | phage tail protein | - |
| M1S35_RS02850 (M1S35_02850) | - | 569960..570790 (-) | 831 | WP_000600984.1 | N-acetylmuramidase family protein | - |
| M1S35_RS02855 (M1S35_02855) | - | 570787..571056 (-) | 270 | WP_000571492.1 | phage holin family protein | - |
| M1S35_RS02860 (M1S35_02860) | - | 571053..571403 (-) | 351 | WP_001114936.1 | putative holin | - |
| M1S35_RS02865 (M1S35_02865) | - | 571412..571621 (-) | 210 | WP_000659473.1 | tail protein X | - |
| M1S35_RS02870 (M1S35_02870) | - | 571622..572074 (-) | 453 | WP_000015689.1 | head completion/stabilization protein | - |
| M1S35_RS02875 (M1S35_02875) | gpM | 572177..572878 (-) | 702 | WP_000950639.1 | phage terminase small subunit | - |
| M1S35_RS02880 (M1S35_02880) | - | 572889..573878 (-) | 990 | WP_001243258.1 | phage major capsid protein, P2 family | - |
| M1S35_RS02885 (M1S35_02885) | - | 573930..574760 (-) | 831 | WP_000748564.1 | GPO family capsid scaffolding protein | - |
| M1S35_RS02890 (M1S35_02890) | - | 574898..576709 (+) | 1812 | WP_000289876.1 | terminase family protein | - |
| M1S35_RS02895 (M1S35_02895) | - | 576709..577707 (+) | 999 | WP_001284080.1 | phage portal protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13319.05 Da Isoelectric Point: 9.7939
>NTDB_id=684065 M1S35_RS02695 WP_001214081.1 546923..547276(-) (ssb) [Acinetobacter baumannii strain 5626]
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=684065 M1S35_RS02695 WP_001214081.1 546923..547276(-) (ssb) [Acinetobacter baumannii strain 5626]
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
56.364 |
94.017 |
0.53 |
| ssb | Vibrio cholerae strain A1552 |
55.556 |
84.615 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
41.905 |
89.744 |
0.376 |
| ssb | Neisseria meningitidis MC58 |
41.905 |
89.744 |
0.376 |