Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M1S58_RS03035 | Genome accession | NZ_CP096727 |
| Coordinates | 597828..598181 (-) | Length | 117 a.a. |
| NCBI ID | WP_001214081.1 | Uniprot ID | - |
| Organism | Acinetobacter baumannii strain 5732 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 595463..629317 | 597828..598181 | within | 0 |
Gene organization within MGE regions
Location: 595463..629317
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1S58_RS03015 (M1S58_03015) | - | 595463..596530 (+) | 1068 | WP_000107856.1 | site-specific integrase | - |
| M1S58_RS03020 (M1S58_03020) | - | 596558..596854 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| M1S58_RS03025 (M1S58_03025) | - | 596851..597072 (-) | 222 | WP_000424583.1 | hypothetical protein | - |
| M1S58_RS03030 (M1S58_03030) | - | 597081..597818 (-) | 738 | WP_000125746.1 | 3'-5' exonuclease | - |
| M1S58_RS03035 (M1S58_03035) | ssb | 597828..598181 (-) | 354 | WP_001214081.1 | single-stranded DNA-binding protein | Machinery gene |
| M1S58_RS03040 (M1S58_03040) | - | 598169..598486 (-) | 318 | WP_000049862.1 | hypothetical protein | - |
| M1S58_RS03045 (M1S58_03045) | - | 598490..599008 (-) | 519 | WP_000877796.1 | hypothetical protein | - |
| M1S58_RS03050 (M1S58_03050) | - | 599011..599442 (-) | 432 | WP_001178667.1 | DUF2528 family protein | - |
| M1S58_RS03055 (M1S58_03055) | - | 599510..599845 (-) | 336 | WP_000841657.1 | hypothetical protein | - |
| M1S58_RS03060 (M1S58_03060) | - | 599842..602580 (-) | 2739 | WP_025464780.1 | toprim domain-containing protein | - |
| M1S58_RS03065 (M1S58_03065) | - | 602674..602865 (-) | 192 | WP_001043481.1 | hypothetical protein | - |
| M1S58_RS03070 (M1S58_03070) | - | 602958..603299 (+) | 342 | WP_000786717.1 | helix-turn-helix transcriptional regulator | - |
| M1S58_RS03075 (M1S58_03075) | - | 603344..603559 (-) | 216 | WP_000556347.1 | hypothetical protein | - |
| M1S58_RS03080 (M1S58_03080) | - | 603660..603905 (-) | 246 | WP_000789360.1 | hypothetical protein | - |
| M1S58_RS03085 (M1S58_03085) | - | 603908..604102 (-) | 195 | WP_002001330.1 | hypothetical protein | - |
| M1S58_RS03090 (M1S58_03090) | - | 604422..604745 (-) | 324 | WP_000720885.1 | DUF2511 domain-containing protein | - |
| M1S58_RS03095 (M1S58_03095) | - | 604825..605466 (+) | 642 | WP_000332608.1 | SOS response-associated peptidase family protein | - |
| M1S58_RS03100 (M1S58_03100) | umuD | 605579..606079 (+) | 501 | WP_000072259.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| M1S58_RS03105 (M1S58_03105) | - | 606076..607371 (+) | 1296 | WP_000679982.1 | Y-family DNA polymerase | - |
| M1S58_RS03110 (M1S58_03110) | - | 607661..607861 (-) | 201 | WP_000130086.1 | TraR/DksA C4-type zinc finger protein | - |
| M1S58_RS03115 (M1S58_03115) | - | 607858..608097 (-) | 240 | WP_000113727.1 | ogr/Delta-like zinc finger family protein | - |
| M1S58_RS03120 (M1S58_03120) | - | 608226..609539 (-) | 1314 | WP_000483168.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| M1S58_RS03125 (M1S58_03125) | - | 609540..609980 (-) | 441 | WP_000979754.1 | phage tail protein | - |
| M1S58_RS03130 (M1S58_03130) | - | 609986..612436 (-) | 2451 | WP_000774269.1 | phage tail tape measure protein | - |
| M1S58_RS20320 | - | 612450..612563 (-) | 114 | WP_074166825.1 | GpE family phage tail protein | - |
| M1S58_RS03135 (M1S58_03135) | - | 612590..612931 (-) | 342 | WP_001071616.1 | phage tail assembly protein | - |
| M1S58_RS03140 (M1S58_03140) | - | 612998..613516 (-) | 519 | WP_001207609.1 | phage major tail tube protein | - |
| M1S58_RS03145 (M1S58_03145) | - | 613529..614704 (-) | 1176 | WP_000963363.1 | phage tail sheath protein | - |
| M1S58_RS03150 (M1S58_03150) | - | 614804..615031 (-) | 228 | WP_001279430.1 | hypothetical protein | - |
| M1S58_RS03155 (M1S58_03155) | - | 615033..617279 (-) | 2247 | WP_000729644.1 | phage tail protein | - |
| M1S58_RS03160 (M1S58_03160) | - | 617291..617896 (-) | 606 | WP_001050806.1 | phage tail protein I | - |
| M1S58_RS03165 (M1S58_03165) | - | 617896..618798 (-) | 903 | WP_000109741.1 | baseplate J/gp47 family protein | - |
| M1S58_RS03170 (M1S58_03170) | - | 618795..619142 (-) | 348 | WP_000987743.1 | GPW/gp25 family protein | - |
| M1S58_RS03175 (M1S58_03175) | - | 619139..619822 (-) | 684 | WP_000990627.1 | phage baseplate assembly protein V | - |
| M1S58_RS03180 (M1S58_03180) | - | 619895..620344 (-) | 450 | WP_001059840.1 | phage virion morphogenesis protein | - |
| M1S58_RS03185 (M1S58_03185) | - | 620341..620868 (-) | 528 | WP_000742887.1 | phage tail protein | - |
| M1S58_RS03190 (M1S58_03190) | - | 620865..621695 (-) | 831 | WP_000600984.1 | N-acetylmuramidase family protein | - |
| M1S58_RS03195 (M1S58_03195) | - | 621692..621961 (-) | 270 | WP_000571492.1 | phage holin family protein | - |
| M1S58_RS03200 (M1S58_03200) | - | 621958..622308 (-) | 351 | WP_001114936.1 | putative holin | - |
| M1S58_RS03205 (M1S58_03205) | - | 622317..622526 (-) | 210 | WP_000659473.1 | tail protein X | - |
| M1S58_RS03210 (M1S58_03210) | - | 622527..622979 (-) | 453 | WP_000015689.1 | head completion/stabilization protein | - |
| M1S58_RS03215 (M1S58_03215) | gpM | 623082..623783 (-) | 702 | WP_000950639.1 | phage terminase small subunit | - |
| M1S58_RS03220 (M1S58_03220) | - | 623794..624783 (-) | 990 | WP_001243258.1 | phage major capsid protein, P2 family | - |
| M1S58_RS03225 (M1S58_03225) | - | 624835..625665 (-) | 831 | WP_000748564.1 | GPO family capsid scaffolding protein | - |
| M1S58_RS03230 (M1S58_03230) | - | 625803..627614 (+) | 1812 | WP_000289876.1 | terminase family protein | - |
| M1S58_RS03235 (M1S58_03235) | - | 627614..628612 (+) | 999 | WP_001284080.1 | phage portal protein | - |
| M1S58_RS03240 (M1S58_03240) | - | 628913..629317 (-) | 405 | WP_001037171.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13319.05 Da Isoelectric Point: 9.7939
>NTDB_id=683254 M1S58_RS03035 WP_001214081.1 597828..598181(-) (ssb) [Acinetobacter baumannii strain 5732]
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=683254 M1S58_RS03035 WP_001214081.1 597828..598181(-) (ssb) [Acinetobacter baumannii strain 5732]
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
56.364 |
94.017 |
0.53 |
| ssb | Vibrio cholerae strain A1552 |
55.556 |
84.615 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
41.905 |
89.744 |
0.376 |
| ssb | Neisseria meningitidis MC58 |
41.905 |
89.744 |
0.376 |