Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M1S15_RS02700 | Genome accession | NZ_CP096700 |
| Coordinates | 548473..548826 (-) | Length | 117 a.a. |
| NCBI ID | WP_001214081.1 | Uniprot ID | - |
| Organism | Acinetobacter baumannii strain 5768 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 546108..579962 | 548473..548826 | within | 0 |
Gene organization within MGE regions
Location: 546108..579962
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1S15_RS02680 (M1S15_02680) | - | 546108..547175 (+) | 1068 | WP_000107856.1 | site-specific integrase | - |
| M1S15_RS02685 (M1S15_02685) | - | 547203..547499 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| M1S15_RS02690 (M1S15_02690) | - | 547496..547717 (-) | 222 | WP_000424583.1 | hypothetical protein | - |
| M1S15_RS02695 (M1S15_02695) | - | 547726..548463 (-) | 738 | WP_000125746.1 | 3'-5' exonuclease | - |
| M1S15_RS02700 (M1S15_02700) | ssb | 548473..548826 (-) | 354 | WP_001214081.1 | single-stranded DNA-binding protein | Machinery gene |
| M1S15_RS02705 (M1S15_02705) | - | 548814..549131 (-) | 318 | WP_000049862.1 | hypothetical protein | - |
| M1S15_RS02710 (M1S15_02710) | - | 549135..549653 (-) | 519 | WP_000877796.1 | hypothetical protein | - |
| M1S15_RS02715 (M1S15_02715) | - | 549656..550087 (-) | 432 | WP_001178667.1 | DUF2528 family protein | - |
| M1S15_RS02720 (M1S15_02720) | - | 550155..550490 (-) | 336 | WP_000841657.1 | hypothetical protein | - |
| M1S15_RS02725 (M1S15_02725) | - | 550487..553225 (-) | 2739 | WP_025464780.1 | toprim domain-containing protein | - |
| M1S15_RS02730 (M1S15_02730) | - | 553319..553510 (-) | 192 | WP_001043481.1 | hypothetical protein | - |
| M1S15_RS02735 (M1S15_02735) | - | 553603..553944 (+) | 342 | WP_000786717.1 | helix-turn-helix transcriptional regulator | - |
| M1S15_RS02740 (M1S15_02740) | - | 553989..554204 (-) | 216 | WP_000556347.1 | hypothetical protein | - |
| M1S15_RS02745 (M1S15_02745) | - | 554305..554550 (-) | 246 | WP_000789360.1 | hypothetical protein | - |
| M1S15_RS02750 (M1S15_02750) | - | 554553..554747 (-) | 195 | WP_002001330.1 | hypothetical protein | - |
| M1S15_RS02755 (M1S15_02755) | - | 555067..555390 (-) | 324 | WP_000720885.1 | DUF2511 domain-containing protein | - |
| M1S15_RS02760 (M1S15_02760) | - | 555470..556111 (+) | 642 | WP_000332608.1 | SOS response-associated peptidase family protein | - |
| M1S15_RS02765 (M1S15_02765) | umuD | 556224..556724 (+) | 501 | WP_000072259.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| M1S15_RS02770 (M1S15_02770) | - | 556721..558016 (+) | 1296 | WP_000679982.1 | Y-family DNA polymerase | - |
| M1S15_RS02775 (M1S15_02775) | - | 558306..558506 (-) | 201 | WP_000130086.1 | TraR/DksA C4-type zinc finger protein | - |
| M1S15_RS02780 (M1S15_02780) | - | 558503..558742 (-) | 240 | WP_000113727.1 | ogr/Delta-like zinc finger family protein | - |
| M1S15_RS02785 (M1S15_02785) | - | 558871..560184 (-) | 1314 | WP_000483168.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| M1S15_RS02790 (M1S15_02790) | - | 560185..560625 (-) | 441 | WP_000979754.1 | phage tail protein | - |
| M1S15_RS02795 (M1S15_02795) | - | 560631..563081 (-) | 2451 | WP_000774269.1 | phage tail tape measure protein | - |
| M1S15_RS20280 | - | 563095..563208 (-) | 114 | WP_074166825.1 | GpE family phage tail protein | - |
| M1S15_RS02800 (M1S15_02800) | - | 563235..563576 (-) | 342 | WP_001071616.1 | phage tail assembly protein | - |
| M1S15_RS02805 (M1S15_02805) | - | 563643..564161 (-) | 519 | WP_001207609.1 | phage major tail tube protein | - |
| M1S15_RS02810 (M1S15_02810) | - | 564174..565349 (-) | 1176 | WP_000963363.1 | phage tail sheath protein | - |
| M1S15_RS02815 (M1S15_02815) | - | 565449..565676 (-) | 228 | WP_001279430.1 | hypothetical protein | - |
| M1S15_RS02820 (M1S15_02820) | - | 565678..567924 (-) | 2247 | WP_000729644.1 | phage tail protein | - |
| M1S15_RS02825 (M1S15_02825) | - | 567936..568541 (-) | 606 | WP_001050806.1 | phage tail protein I | - |
| M1S15_RS02830 (M1S15_02830) | - | 568541..569443 (-) | 903 | WP_000109741.1 | baseplate J/gp47 family protein | - |
| M1S15_RS02835 (M1S15_02835) | - | 569440..569787 (-) | 348 | WP_000987743.1 | GPW/gp25 family protein | - |
| M1S15_RS02840 (M1S15_02840) | - | 569784..570467 (-) | 684 | WP_000990627.1 | phage baseplate assembly protein V | - |
| M1S15_RS02845 (M1S15_02845) | - | 570540..570989 (-) | 450 | WP_001059840.1 | phage virion morphogenesis protein | - |
| M1S15_RS02850 (M1S15_02850) | - | 570986..571513 (-) | 528 | WP_000742887.1 | phage tail protein | - |
| M1S15_RS02855 (M1S15_02855) | - | 571510..572340 (-) | 831 | WP_000600984.1 | N-acetylmuramidase family protein | - |
| M1S15_RS02860 (M1S15_02860) | - | 572337..572606 (-) | 270 | WP_000571492.1 | phage holin family protein | - |
| M1S15_RS02865 (M1S15_02865) | - | 572603..572953 (-) | 351 | WP_001114936.1 | putative holin | - |
| M1S15_RS02870 (M1S15_02870) | - | 572962..573171 (-) | 210 | WP_000659473.1 | tail protein X | - |
| M1S15_RS02875 (M1S15_02875) | - | 573172..573624 (-) | 453 | WP_000015689.1 | head completion/stabilization protein | - |
| M1S15_RS02880 (M1S15_02880) | gpM | 573727..574428 (-) | 702 | WP_000950639.1 | phage terminase small subunit | - |
| M1S15_RS02885 (M1S15_02885) | - | 574439..575428 (-) | 990 | WP_001243258.1 | phage major capsid protein, P2 family | - |
| M1S15_RS02890 (M1S15_02890) | - | 575480..576310 (-) | 831 | WP_000748564.1 | GPO family capsid scaffolding protein | - |
| M1S15_RS02895 (M1S15_02895) | - | 576448..578259 (+) | 1812 | WP_000289876.1 | terminase family protein | - |
| M1S15_RS02900 (M1S15_02900) | - | 578259..579257 (+) | 999 | WP_001284080.1 | phage portal protein | - |
| M1S15_RS02905 (M1S15_02905) | - | 579558..579962 (-) | 405 | WP_001037171.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13319.05 Da Isoelectric Point: 9.7939
>NTDB_id=682731 M1S15_RS02700 WP_001214081.1 548473..548826(-) (ssb) [Acinetobacter baumannii strain 5768]
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=682731 M1S15_RS02700 WP_001214081.1 548473..548826(-) (ssb) [Acinetobacter baumannii strain 5768]
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
56.364 |
94.017 |
0.53 |
| ssb | Vibrio cholerae strain A1552 |
55.556 |
84.615 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
41.905 |
89.744 |
0.376 |
| ssb | Neisseria meningitidis MC58 |
41.905 |
89.744 |
0.376 |