Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPATCC43504_RS01145 Genome accession   NZ_AP017632
Coordinates   244870..244983 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain ATCC 43504     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 239870..249983
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPATCC43504_RS01120 (HPATCC43504_00226) - 239923..242148 (+) 2226 WP_108169554.1 ATP-dependent Clp protease ATP-binding subunit -
  HPATCC43504_RS01125 (HPATCC43504_00227) panD 242138..242491 (+) 354 WP_000142226.1 aspartate 1-decarboxylase -
  HPATCC43504_RS01130 (HPATCC43504_00228) - 242494..242796 (+) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  HPATCC43504_RS01135 (HPATCC43504_00229) - 242796..243791 (+) 996 WP_108169555.1 PDZ domain-containing protein -
  HPATCC43504_RS01140 (HPATCC43504_00230) comB6 243799..244854 (+) 1056 WP_108169556.1 P-type conjugative transfer protein TrbL Machinery gene
  HPATCC43504_RS01145 (HPATCC43504_00231) comB7 244870..244983 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPATCC43504_RS01150 (HPATCC43504_00232) comB8 244980..245717 (+) 738 WP_000660523.1 virB8 family protein Machinery gene
  HPATCC43504_RS01155 (HPATCC43504_00233) comB9 245717..246697 (+) 981 WP_108169557.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPATCC43504_RS01160 (HPATCC43504_00234) comB10 246690..247826 (+) 1137 WP_108169558.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPATCC43504_RS01165 (HPATCC43504_00235) - 247897..249309 (+) 1413 WP_108169559.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=68272 HPATCC43504_RS01145 WP_001217873.1 244870..244983(+) (comB7) [Helicobacter pylori strain ATCC 43504]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=68272 HPATCC43504_RS01145 WP_001217873.1 244870..244983(+) (comB7) [Helicobacter pylori strain ATCC 43504]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment