Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   MYW70_RS10740 Genome accession   NZ_CP095785
Coordinates   2381476..2381892 (+) Length   138 a.a.
NCBI ID   WP_337236960.1    Uniprot ID   -
Organism   Proteus faecis strain 19MO01SH08     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2335233..2389068 2381476..2381892 within 0


Gene organization within MGE regions


Location: 2335233..2389068
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MYW70_RS10445 (MYW70_10465) mepS 2335233..2335847 (+) 615 WP_109397934.1 bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase -
  MYW70_RS10450 (MYW70_10470) - 2335972..2336319 (-) 348 WP_072062745.1 YejG family protein -
  MYW70_RS10455 (MYW70_10475) - 2336842..2338026 (-) 1185 WP_109397935.1 Bcr/CflA family multidrug efflux MFS transporter -
  MYW70_RS10460 (MYW70_10480) rsuA 2338064..2338768 (-) 705 WP_109397936.1 16S rRNA pseudouridine(516) synthase RsuA -
  MYW70_RS10465 (MYW70_10485) - 2338952..2340715 (+) 1764 WP_185900898.1 DEAD/DEAH box helicase -
  MYW70_RS10470 (MYW70_10490) rplY 2340860..2341144 (+) 285 WP_023581385.1 50S ribosomal protein L25 -
  MYW70_RS10475 (MYW70_10495) yejK 2341228..2342232 (-) 1005 WP_099074944.1 nucleoid-associated protein YejK -
  MYW70_RS10480 (MYW70_10500) - 2342388..2342615 (+) 228 WP_004247042.1 YejL family protein -
  MYW70_RS10485 (MYW70_10505) yejM 2342642..2344378 (+) 1737 WP_249718459.1 LPS biosynthesis-modulating metalloenzyme YejM -
  MYW70_RS10495 (MYW70_10515) - 2344720..2344953 (+) 234 WP_185900900.1 DNA polymerase III subunit theta -
  MYW70_RS10500 (MYW70_10520) - 2345313..2345567 (-) 255 WP_185900901.1 colicin E3-like toxin immunity protein -
  MYW70_RS10505 (MYW70_10525) - 2345578..2347326 (-) 1749 WP_342639526.1 colicin E3/pyocin S6 family cytotoxin -
  MYW70_RS10510 (MYW70_10530) - 2347516..2348916 (-) 1401 WP_185902004.1 hypothetical protein -
  MYW70_RS10515 (MYW70_10535) - 2348935..2352657 (-) 3723 WP_342639527.1 phage tail protein -
  MYW70_RS10520 (MYW70_10540) - 2352677..2353270 (-) 594 WP_023582499.1 tail assembly protein -
  MYW70_RS10525 (MYW70_10545) - 2353324..2354187 (-) 864 WP_211823868.1 tetratricopeptide repeat protein -
  MYW70_RS10530 (MYW70_10550) - 2354266..2354973 (-) 708 WP_261191464.1 C40 family peptidase -
  MYW70_RS10535 (MYW70_10555) - 2354979..2355731 (-) 753 WP_342639959.1 phage minor tail protein L -
  MYW70_RS10540 (MYW70_10560) - 2355725..2356057 (-) 333 WP_342639528.1 phage tail protein -
  MYW70_RS10545 (MYW70_10565) - 2356060..2359326 (-) 3267 WP_342639529.1 phage tail tape measure protein -
  MYW70_RS10550 (MYW70_10570) - 2359346..2359609 (-) 264 WP_260619563.1 DUF4035 domain-containing protein -
  MYW70_RS10555 (MYW70_10575) - 2359651..2360031 (-) 381 WP_185901999.1 phage tail assembly chaperone -
  MYW70_RS10560 (MYW70_10580) - 2360034..2360501 (-) 468 WP_261191417.1 phage tail tube protein -
  MYW70_RS10565 (MYW70_10585) - 2360567..2360902 (-) 336 WP_185901998.1 hypothetical protein -
  MYW70_RS10570 (MYW70_10590) - 2360899..2361339 (-) 441 WP_023582509.1 HK97-gp10 family putative phage morphogenesis protein -
  MYW70_RS10575 (MYW70_10595) - 2361336..2361659 (-) 324 WP_109400960.1 phage head closure protein -
  MYW70_RS10580 (MYW70_10600) - 2361656..2361964 (-) 309 WP_287216784.1 head-tail connector protein -
  MYW70_RS10585 (MYW70_10605) - 2362060..2363268 (-) 1209 WP_196544020.1 phage major capsid protein -
  MYW70_RS10590 (MYW70_10610) - 2363282..2363926 (-) 645 WP_181879874.1 HK97 family phage prohead protease -
  MYW70_RS10595 (MYW70_10615) - 2363904..2365133 (-) 1230 WP_342639530.1 phage portal protein -
  MYW70_RS10600 (MYW70_10620) - 2365133..2365312 (-) 180 WP_342639531.1 hypothetical protein -
  MYW70_RS10605 (MYW70_10625) - 2365322..2367012 (-) 1691 Protein_2063 terminase TerL endonuclease subunit -
  MYW70_RS10610 (MYW70_10630) - 2367016..2367489 (-) 474 WP_161751967.1 phage terminase small subunit P27 family -
  MYW70_RS10615 (MYW70_10635) - 2367652..2367999 (-) 348 WP_342639532.1 HNH endonuclease signature motif containing protein -
  MYW70_RS10620 (MYW70_10640) - 2368058..2368369 (-) 312 WP_342639533.1 hypothetical protein -
  MYW70_RS10625 (MYW70_10645) - 2368489..2369019 (-) 531 WP_342639534.1 hypothetical protein -
  MYW70_RS10630 (MYW70_10650) - 2369189..2369650 (-) 462 WP_342639535.1 lysis protein -
  MYW70_RS10635 (MYW70_10655) - 2369653..2369820 (-) 168 WP_342639536.1 hypothetical protein -
  MYW70_RS10640 (MYW70_10660) - 2369802..2370272 (-) 471 WP_342639537.1 lysozyme -
  MYW70_RS10645 (MYW70_10665) - 2370272..2370541 (-) 270 WP_036904926.1 bacteriophage protein -
  MYW70_RS10650 (MYW70_10670) - 2370919..2371521 (-) 603 WP_342639538.1 hypothetical protein -
  MYW70_RS10655 (MYW70_10675) - 2371535..2372524 (-) 990 WP_311750124.1 DUF4747 family protein -
  MYW70_RS10660 (MYW70_10680) - 2372783..2373565 (-) 783 WP_342639539.1 antitermination protein -
  MYW70_RS10665 (MYW70_10685) - 2373593..2374618 (-) 1026 WP_342639540.1 DUF968 domain-containing protein -
  MYW70_RS10670 (MYW70_10690) - 2374615..2374749 (-) 135 Protein_2076 KilA-N domain-containing protein -
  MYW70_RS10675 (MYW70_10695) - 2374834..2375220 (-) 387 WP_109400945.1 RusA family crossover junction endodeoxyribonuclease -
  MYW70_RS10680 (MYW70_10700) - 2375293..2376384 (-) 1092 WP_270756934.1 replication protein -
  MYW70_RS10685 (MYW70_10705) - 2376397..2376576 (-) 180 WP_099659597.1 DUF4222 domain-containing protein -
  MYW70_RS10690 (MYW70_10710) - 2376566..2376775 (-) 210 WP_036904895.1 hypothetical protein -
  MYW70_RS10695 (MYW70_10715) - 2376864..2377322 (-) 459 WP_109400941.1 YmfL family putative regulatory protein -
  MYW70_RS10700 (MYW70_10720) - 2377361..2377588 (-) 228 WP_023582536.1 helix-turn-helix transcriptional regulator -
  MYW70_RS10705 (MYW70_10725) - 2377684..2378340 (+) 657 WP_196544038.1 S24 family peptidase -
  MYW70_RS10710 (MYW70_10730) - 2378409..2378888 (+) 480 WP_196544039.1 hypothetical protein -
  MYW70_RS10715 (MYW70_10735) - 2378885..2379832 (+) 948 WP_196544040.1 hypothetical protein -
  MYW70_RS10720 (MYW70_10740) - 2380070..2380273 (+) 204 WP_196544041.1 hypothetical protein -
  MYW70_RS10725 (MYW70_10745) - 2380330..2380554 (+) 225 WP_100159834.1 hypothetical protein -
  MYW70_RS10730 (MYW70_10750) - 2380532..2380765 (-) 234 WP_088496049.1 hypothetical protein -
  MYW70_RS10735 (MYW70_10755) - 2380950..2381483 (+) 534 WP_196544042.1 HD family hydrolase -
  MYW70_RS10740 (MYW70_10760) ssb 2381476..2381892 (+) 417 WP_337236960.1 single-stranded DNA-binding protein Machinery gene
  MYW70_RS10745 (MYW70_10765) - 2382238..2382444 (+) 207 WP_185902261.1 hypothetical protein -
  MYW70_RS10750 (MYW70_10770) - 2382446..2383627 (+) 1182 WP_074924370.1 phage integrase SAM-like domain-containing protein -
  MYW70_RS10755 (MYW70_10775) - 2384273..2384842 (-) 570 WP_342639541.1 hypothetical protein -
  MYW70_RS10760 (MYW70_10780) - 2385716..2386276 (-) 561 WP_342639542.1 alpha/beta fold hydrolase -
  MYW70_RS10765 (MYW70_10785) - 2386937..2387113 (-) 177 WP_185901974.1 hypothetical protein -
  MYW70_RS10770 (MYW70_10790) - 2388757..2389068 (+) 312 WP_342639543.1 hypothetical protein -

Sequence

Protein


Download         Length: 138 a.a.        Molecular weight: 15057.08 Da        Isoelectric Point: 7.9864

>NTDB_id=678450 MYW70_RS10740 WP_337236960.1 2381476..2381892(+) (ssb) [Proteus faecis strain 19MO01SH08]
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSEKWRDKQTGDNREKTEWHRVVLFGKLADIASGYLCKGSQIYI
EGQLQTREWDDNGVKRYTTEIVVKVGGSMQMLGGAIKSTTSQTTPLSQPPVGFDDIPF

Nucleotide


Download         Length: 417 bp        

>NTDB_id=678450 MYW70_RS10740 WP_337236960.1 2381476..2381892(+) (ssb) [Proteus faecis strain 19MO01SH08]
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGTAATTTAGGTCGTGATCCTGAAATTCGTTATCTTCCCTCTGG
TGGTGCTGTTGCTAATTTAGCTGTGGCCACATCAGAAAAGTGGCGAGATAAACAAACGGGTGACAACCGAGAAAAGACAG
AATGGCACCGTGTCGTTCTGTTTGGAAAACTCGCAGATATCGCCAGTGGCTATTTGTGCAAAGGCTCTCAAATTTATATT
GAGGGCCAACTACAAACGCGCGAATGGGATGATAACGGTGTTAAACGCTATACAACAGAAATTGTTGTAAAAGTTGGCGG
TTCGATGCAGATGCTAGGTGGTGCAATTAAATCGACAACTTCACAGACTACACCACTATCACAACCCCCCGTAGGTTTTG
ATGATATTCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-111)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

69.828

84.058

0.587
  ssb Glaesserella parasuis strain SC1401

59.259

78.261

0.464
  ssb Neisseria meningitidis MC58

51.351

80.435

0.413
  ssb Neisseria gonorrhoeae MS11

51.351

80.435

0.413