Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MYW70_RS03765 | Genome accession | NZ_CP095785 |
| Coordinates | 877812..878309 (-) | Length | 165 a.a. |
| NCBI ID | WP_342639802.1 | Uniprot ID | - |
| Organism | Proteus faecis strain 19MO01SH08 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 875755..915415 | 877812..878309 | within | 0 |
Gene organization within MGE regions
Location: 875755..915415
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MYW70_RS03740 (MYW70_03745) | - | 875755..875943 (-) | 189 | WP_099660096.1 | AlpA family phage regulatory protein | - |
| MYW70_RS03745 (MYW70_03750) | - | 875994..876431 (-) | 438 | WP_342639798.1 | SAM-dependent methyltransferase | - |
| MYW70_RS03750 (MYW70_03755) | - | 876451..876672 (-) | 222 | WP_342639799.1 | hypothetical protein | - |
| MYW70_RS03755 (MYW70_03760) | - | 876675..877346 (-) | 672 | WP_342639800.1 | hypothetical protein | - |
| MYW70_RS03760 (MYW70_03765) | - | 877348..877803 (-) | 456 | WP_342639801.1 | hypothetical protein | - |
| MYW70_RS03765 (MYW70_03770) | ssb | 877812..878309 (-) | 498 | WP_342639802.1 | single-stranded DNA-binding protein | Machinery gene |
| MYW70_RS03770 (MYW70_03775) | - | 878302..878835 (-) | 534 | WP_342639803.1 | HD family hydrolase | - |
| MYW70_RS03775 (MYW70_03780) | - | 879020..879253 (+) | 234 | WP_088496049.1 | hypothetical protein | - |
| MYW70_RS03780 (MYW70_03785) | - | 879231..879455 (-) | 225 | WP_100159834.1 | hypothetical protein | - |
| MYW70_RS03785 (MYW70_03790) | - | 879512..879715 (-) | 204 | WP_337236955.1 | hypothetical protein | - |
| MYW70_RS03790 (MYW70_03795) | - | 879827..880474 (-) | 648 | WP_337236953.1 | S24 family peptidase | - |
| MYW70_RS03795 (MYW70_03800) | - | 880580..880774 (+) | 195 | WP_109397866.1 | Cro/CI family transcriptional regulator | - |
| MYW70_RS03800 (MYW70_03805) | - | 880813..881271 (+) | 459 | WP_342639804.1 | YmfL family putative regulatory protein | - |
| MYW70_RS03805 (MYW70_03810) | - | 881360..881533 (+) | 174 | WP_004251659.1 | hypothetical protein | - |
| MYW70_RS03810 (MYW70_03815) | - | 881530..881709 (+) | 180 | WP_064720326.1 | DUF4222 domain-containing protein | - |
| MYW70_RS03815 (MYW70_03820) | - | 881866..882840 (+) | 975 | WP_342639805.1 | replication protein 15 | - |
| MYW70_RS03820 (MYW70_03825) | - | 882837..883475 (+) | 639 | WP_161681283.1 | phage N-6-adenine-methyltransferase | - |
| MYW70_RS03825 (MYW70_03830) | - | 883472..883864 (+) | 393 | WP_261191430.1 | hypothetical protein | - |
| MYW70_RS03830 (MYW70_03835) | - | 883937..884320 (+) | 384 | WP_109373182.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MYW70_RS03835 (MYW70_03840) | - | 884339..885142 (+) | 804 | WP_115370631.1 | KilA-N domain-containing protein | - |
| MYW70_RS03840 (MYW70_03845) | - | 885139..886164 (+) | 1026 | WP_342639806.1 | DUF968 domain-containing protein | - |
| MYW70_RS03845 (MYW70_03850) | - | 886192..886587 (+) | 396 | WP_099659601.1 | antiterminator Q family protein | - |
| MYW70_RS03850 (MYW70_03855) | - | 886749..887057 (+) | 309 | WP_342639807.1 | hypothetical protein | - |
| MYW70_RS03855 (MYW70_03860) | - | 887201..887425 (+) | 225 | WP_342639808.1 | hypothetical protein | - |
| MYW70_RS03860 (MYW70_03865) | - | 887397..887636 (-) | 240 | WP_072069175.1 | hypothetical protein | - |
| MYW70_RS03865 (MYW70_03870) | - | 887789..888133 (+) | 345 | WP_342639809.1 | hypothetical protein | - |
| MYW70_RS03870 (MYW70_03875) | - | 888233..888502 (+) | 270 | WP_342639810.1 | hypothetical protein | - |
| MYW70_RS03875 (MYW70_03880) | - | 888502..888972 (+) | 471 | WP_342639811.1 | lysozyme | - |
| MYW70_RS03880 (MYW70_03885) | - | 888954..889112 (+) | 159 | WP_342639812.1 | hypothetical protein | - |
| MYW70_RS03885 (MYW70_03890) | - | 889115..889516 (+) | 402 | WP_342639813.1 | hypothetical protein | - |
| MYW70_RS03890 (MYW70_03895) | - | 889775..889975 (+) | 201 | WP_311749809.1 | hypothetical protein | - |
| MYW70_RS03895 (MYW70_03900) | - | 890415..890792 (+) | 378 | WP_198813423.1 | hypothetical protein | - |
| MYW70_RS03900 (MYW70_03905) | - | 890858..891208 (+) | 351 | WP_342639814.1 | HNH endonuclease signature motif containing protein | - |
| MYW70_RS03905 (MYW70_03910) | - | 891205..891402 (+) | 198 | WP_342639815.1 | hypothetical protein | - |
| MYW70_RS03910 (MYW70_03915) | - | 891550..892023 (+) | 474 | WP_036904945.1 | phage terminase small subunit P27 family | - |
| MYW70_RS03915 (MYW70_03920) | - | 892027..893760 (+) | 1734 | WP_342639816.1 | terminase TerL endonuclease subunit | - |
| MYW70_RS03920 (MYW70_03925) | - | 893770..893949 (+) | 180 | WP_342639817.1 | hypothetical protein | - |
| MYW70_RS03925 (MYW70_03930) | - | 893949..895178 (+) | 1230 | WP_342639530.1 | phage portal protein | - |
| MYW70_RS03930 (MYW70_03935) | - | 895156..895800 (+) | 645 | WP_181879874.1 | HK97 family phage prohead protease | - |
| MYW70_RS03935 (MYW70_03940) | - | 895814..897022 (+) | 1209 | WP_161711126.1 | phage major capsid protein | - |
| MYW70_RS03940 (MYW70_03945) | - | 897118..897426 (+) | 309 | WP_088495899.1 | head-tail connector protein | - |
| MYW70_RS03945 (MYW70_03950) | - | 897423..897746 (+) | 324 | WP_109400960.1 | phage head closure protein | - |
| MYW70_RS03950 (MYW70_03955) | - | 897743..898183 (+) | 441 | WP_023582509.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MYW70_RS03955 (MYW70_03960) | - | 898180..898515 (+) | 336 | WP_185901998.1 | hypothetical protein | - |
| MYW70_RS03960 (MYW70_03965) | - | 898581..899048 (+) | 468 | WP_261191417.1 | phage tail tube protein | - |
| MYW70_RS03965 (MYW70_03970) | - | 899051..899431 (+) | 381 | WP_185901999.1 | phage tail assembly chaperone | - |
| MYW70_RS03970 (MYW70_03975) | - | 899473..899736 (+) | 264 | WP_260619563.1 | DUF4035 domain-containing protein | - |
| MYW70_RS03975 (MYW70_03980) | - | 899756..902995 (+) | 3240 | WP_342639818.1 | phage tail tape measure protein | - |
| MYW70_RS03980 (MYW70_03985) | - | 902998..903330 (+) | 333 | WP_069366999.1 | phage tail protein | - |
| MYW70_RS03985 (MYW70_03990) | - | 903324..904076 (+) | 753 | WP_342639950.1 | phage minor tail protein L | - |
| MYW70_RS03990 (MYW70_03995) | - | 904082..904804 (+) | 723 | WP_069367030.1 | C40 family peptidase | - |
| MYW70_RS03995 (MYW70_04000) | - | 904801..905277 (+) | 477 | WP_069366997.1 | hypothetical protein | - |
| MYW70_RS04000 (MYW70_04005) | - | 905342..905935 (+) | 594 | WP_023582499.1 | tail assembly protein | - |
| MYW70_RS04005 (MYW70_04010) | - | 905955..909362 (+) | 3408 | WP_342639819.1 | phage tail protein | - |
| MYW70_RS04010 (MYW70_04015) | - | 909365..910417 (+) | 1053 | WP_342639820.1 | hypothetical protein | - |
| MYW70_RS04015 (MYW70_04020) | - | 910453..911853 (+) | 1401 | WP_342639821.1 | hypothetical protein | - |
| MYW70_RS04020 (MYW70_04025) | - | 912003..913841 (+) | 1839 | WP_342639822.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
| MYW70_RS04025 (MYW70_04030) | - | 913844..914101 (+) | 258 | WP_036969576.1 | bacteriocin immunity protein | - |
| MYW70_RS04030 (MYW70_04035) | - | 914189..915415 (-) | 1227 | WP_287219013.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 165 a.a. Molecular weight: 17991.40 Da Isoelectric Point: 7.1332
>NTDB_id=678446 MYW70_RS03765 WP_342639802.1 877812..878309(-) (ssb) [Proteus faecis strain 19MO01SH08]
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSEKWRDKQTGDNREKTEWHRVVLFGKLADIASGYLCKGSQIYI
EGQLQTREWDDNGVKRYTTEIVVKVGGSMQMLGGASKSAGSQSAQQNLPSAQSQAPRNQPPMDFEDDIPFAPIGLMYPCH
LINVI
MANGSVNKVILIGNLGRDPEIRYLPSGGAVANLAVATSEKWRDKQTGDNREKTEWHRVVLFGKLADIASGYLCKGSQIYI
EGQLQTREWDDNGVKRYTTEIVVKVGGSMQMLGGASKSAGSQSAQQNLPSAQSQAPRNQPPMDFEDDIPFAPIGLMYPCH
LINVI
Nucleotide
Download Length: 498 bp
>NTDB_id=678446 MYW70_RS03765 WP_342639802.1 877812..878309(-) (ssb) [Proteus faecis strain 19MO01SH08]
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGCAATTTAGGCCGTGATCCTGAAATTCGCTACCTGCCTTCTGG
TGGTGCTGTTGCTAATTTAGCTGTGGCCACAAGTGAAAAATGGCGAGATAAACAAACGGGTGACAACCGAGAAAAGACAG
AATGGCACCGTGTCGTTCTGTTTGGAAAACTCGCAGATATCGCCAGTGGCTATTTGTGCAAAGGCTCTCAAATTTATATT
GAGGGCCAACTACAAACGCGCGAATGGGATGATAACGGTGTTAAACGCTATACAACAGAAATTGTTGTAAAAGTTGGCGG
TTCGATGCAGATGCTAGGTGGTGCTAGTAAATCAGCAGGGTCACAGTCGGCACAGCAAAACCTGCCATCAGCTCAATCTC
AAGCACCGCGAAATCAGCCACCAATGGATTTTGAAGATGACATCCCTTTCGCACCGATTGGGCTTATGTATCCATGCCAT
TTAATTAATGTGATTTAG
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGCAATTTAGGCCGTGATCCTGAAATTCGCTACCTGCCTTCTGG
TGGTGCTGTTGCTAATTTAGCTGTGGCCACAAGTGAAAAATGGCGAGATAAACAAACGGGTGACAACCGAGAAAAGACAG
AATGGCACCGTGTCGTTCTGTTTGGAAAACTCGCAGATATCGCCAGTGGCTATTTGTGCAAAGGCTCTCAAATTTATATT
GAGGGCCAACTACAAACGCGCGAATGGGATGATAACGGTGTTAAACGCTATACAACAGAAATTGTTGTAAAAGTTGGCGG
TTCGATGCAGATGCTAGGTGGTGCTAGTAAATCAGCAGGGTCACAGTCGGCACAGCAAAACCTGCCATCAGCTCAATCTC
AAGCACCGCGAAATCAGCCACCAATGGATTTTGAAGATGACATCCCTTTCGCACCGATTGGGCTTATGTATCCATGCCAT
TTAATTAATGTGATTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
55.932 |
100 |
0.6 |
| ssb | Glaesserella parasuis strain SC1401 |
46.667 |
100 |
0.509 |
| ssb | Neisseria meningitidis MC58 |
43.258 |
100 |
0.467 |
| ssb | Neisseria gonorrhoeae MS11 |
42.373 |
100 |
0.455 |