Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   MUU70_RS11450 Genome accession   NZ_CP095093
Coordinates   2387776..2388213 (-) Length   145 a.a.
NCBI ID   WP_044053464.1    Uniprot ID   -
Organism   Bacillus velezensis strain D103     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2382776..2393213
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUU70_RS11400 (MUU70_11415) sinI 2383161..2383334 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  MUU70_RS11405 (MUU70_11420) sinR 2383368..2383703 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MUU70_RS11410 (MUU70_11425) tasA 2383751..2384536 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  MUU70_RS11415 (MUU70_11430) sipW 2384600..2385184 (-) 585 WP_367069085.1 signal peptidase I SipW -
  MUU70_RS11420 (MUU70_11435) tapA 2385156..2385827 (-) 672 WP_367069086.1 amyloid fiber anchoring/assembly protein TapA -
  MUU70_RS11425 (MUU70_11440) - 2386086..2386415 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  MUU70_RS11430 (MUU70_11445) - 2386455..2386634 (-) 180 WP_003153093.1 YqzE family protein -
  MUU70_RS11435 (MUU70_11450) comGG 2386691..2387068 (-) 378 WP_182069279.1 competence type IV pilus minor pilin ComGG Machinery gene
  MUU70_RS11440 (MUU70_11455) comGF 2387069..2387464 (-) 396 WP_077722593.1 competence type IV pilus minor pilin ComGF -
  MUU70_RS11445 (MUU70_11460) comGE 2387478..2387792 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  MUU70_RS11450 (MUU70_11465) comGD 2387776..2388213 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  MUU70_RS11455 (MUU70_11470) comGC 2388203..2388511 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  MUU70_RS11460 (MUU70_11475) comGB 2388516..2389553 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  MUU70_RS11465 (MUU70_11480) comGA 2389540..2390610 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  MUU70_RS11470 (MUU70_11485) - 2390802..2391752 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -
  MUU70_RS11475 (MUU70_11490) - 2391898..2393199 (+) 1302 WP_070082114.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16282.81 Da        Isoelectric Point: 10.3354

>NTDB_id=675319 MUU70_RS11450 WP_044053464.1 2387776..2388213(-) (comGD) [Bacillus velezensis strain D103]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=675319 MUU70_RS11450 WP_044053464.1 2387776..2388213(-) (comGD) [Bacillus velezensis strain D103]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTACCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAATGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCTGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566