Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | MUU70_RS11400 | Genome accession | NZ_CP095093 |
| Coordinates | 2383161..2383334 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain D103 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2378161..2388334
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUU70_RS11385 (MUU70_11400) | gcvT | 2378978..2380078 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MUU70_RS11390 (MUU70_11405) | - | 2380502..2382172 (+) | 1671 | WP_060562612.1 | DEAD/DEAH box helicase | - |
| MUU70_RS11395 (MUU70_11410) | - | 2382190..2382984 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| MUU70_RS11400 (MUU70_11415) | sinI | 2383161..2383334 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| MUU70_RS11405 (MUU70_11420) | sinR | 2383368..2383703 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| MUU70_RS11410 (MUU70_11425) | tasA | 2383751..2384536 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| MUU70_RS11415 (MUU70_11430) | sipW | 2384600..2385184 (-) | 585 | WP_367069085.1 | signal peptidase I SipW | - |
| MUU70_RS11420 (MUU70_11435) | tapA | 2385156..2385827 (-) | 672 | WP_367069086.1 | amyloid fiber anchoring/assembly protein TapA | - |
| MUU70_RS11425 (MUU70_11440) | - | 2386086..2386415 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| MUU70_RS11430 (MUU70_11445) | - | 2386455..2386634 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| MUU70_RS11435 (MUU70_11450) | comGG | 2386691..2387068 (-) | 378 | WP_182069279.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MUU70_RS11440 (MUU70_11455) | comGF | 2387069..2387464 (-) | 396 | WP_077722593.1 | competence type IV pilus minor pilin ComGF | - |
| MUU70_RS11445 (MUU70_11460) | comGE | 2387478..2387792 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| MUU70_RS11450 (MUU70_11465) | comGD | 2387776..2388213 (-) | 438 | WP_044053464.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=675315 MUU70_RS11400 WP_003153105.1 2383161..2383334(+) (sinI) [Bacillus velezensis strain D103]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=675315 MUU70_RS11400 WP_003153105.1 2383161..2383334(+) (sinI) [Bacillus velezensis strain D103]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |