Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MUU70_RS11400 Genome accession   NZ_CP095093
Coordinates   2383161..2383334 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain D103     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2378161..2388334
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUU70_RS11385 (MUU70_11400) gcvT 2378978..2380078 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  MUU70_RS11390 (MUU70_11405) - 2380502..2382172 (+) 1671 WP_060562612.1 DEAD/DEAH box helicase -
  MUU70_RS11395 (MUU70_11410) - 2382190..2382984 (+) 795 WP_014305407.1 YqhG family protein -
  MUU70_RS11400 (MUU70_11415) sinI 2383161..2383334 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  MUU70_RS11405 (MUU70_11420) sinR 2383368..2383703 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MUU70_RS11410 (MUU70_11425) tasA 2383751..2384536 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  MUU70_RS11415 (MUU70_11430) sipW 2384600..2385184 (-) 585 WP_367069085.1 signal peptidase I SipW -
  MUU70_RS11420 (MUU70_11435) tapA 2385156..2385827 (-) 672 WP_367069086.1 amyloid fiber anchoring/assembly protein TapA -
  MUU70_RS11425 (MUU70_11440) - 2386086..2386415 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  MUU70_RS11430 (MUU70_11445) - 2386455..2386634 (-) 180 WP_003153093.1 YqzE family protein -
  MUU70_RS11435 (MUU70_11450) comGG 2386691..2387068 (-) 378 WP_182069279.1 competence type IV pilus minor pilin ComGG Machinery gene
  MUU70_RS11440 (MUU70_11455) comGF 2387069..2387464 (-) 396 WP_077722593.1 competence type IV pilus minor pilin ComGF -
  MUU70_RS11445 (MUU70_11460) comGE 2387478..2387792 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  MUU70_RS11450 (MUU70_11465) comGD 2387776..2388213 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=675315 MUU70_RS11400 WP_003153105.1 2383161..2383334(+) (sinI) [Bacillus velezensis strain D103]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=675315 MUU70_RS11400 WP_003153105.1 2383161..2383334(+) (sinI) [Bacillus velezensis strain D103]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702