Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MTP23_RS14565 | Genome accession | NZ_CP094443 |
| Coordinates | 2902427..2902897 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain N10CSA27 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2865900..2907944 | 2902427..2902897 | within | 0 |
Gene organization within MGE regions
Location: 2865900..2907944
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTP23_RS14305 (MTP23_14305) | groES | 2865900..2866184 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| MTP23_RS14310 (MTP23_14310) | groL | 2866260..2867876 (+) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| MTP23_RS14315 (MTP23_14315) | - | 2867945..2869117 (-) | 1173 | WP_000179353.1 | tyrosine-type recombinase/integrase | - |
| MTP23_RS14320 (MTP23_14320) | - | 2869131..2869853 (-) | 723 | WP_000672427.1 | helix-turn-helix transcriptional regulator | - |
| MTP23_RS14325 (MTP23_14325) | - | 2870006..2870212 (+) | 207 | WP_000794657.1 | helix-turn-helix transcriptional regulator | - |
| MTP23_RS14330 (MTP23_14330) | - | 2870216..2870533 (+) | 318 | WP_000481968.1 | helix-turn-helix domain-containing protein | - |
| MTP23_RS14335 (MTP23_14335) | - | 2870530..2870676 (+) | 147 | WP_000708434.1 | hypothetical protein | - |
| MTP23_RS14340 (MTP23_14340) | - | 2870669..2870878 (+) | 210 | WP_001058487.1 | hypothetical protein | - |
| MTP23_RS14345 (MTP23_14345) | - | 2870881..2871198 (+) | 318 | WP_001103933.1 | DUF1474 family protein | - |
| MTP23_RS14350 (MTP23_14350) | - | 2871265..2872134 (+) | 870 | WP_001002699.1 | primase alpha helix C-terminal domain-containing protein | - |
| MTP23_RS14355 (MTP23_14355) | - | 2872151..2873620 (+) | 1470 | WP_001838755.1 | virulence-associated E family protein | - |
| MTP23_RS14360 (MTP23_14360) | - | 2873906..2874268 (+) | 363 | WP_001039169.1 | hypothetical protein | - |
| MTP23_RS14365 (MTP23_14365) | - | 2874270..2874554 (+) | 285 | WP_000998179.1 | hypothetical protein | - |
| MTP23_RS14370 (MTP23_14370) | - | 2874551..2875192 (+) | 642 | WP_001019811.1 | hypothetical protein | - |
| MTP23_RS14375 (MTP23_14375) | - | 2875728..2876069 (+) | 342 | WP_000443639.1 | hypothetical protein | - |
| MTP23_RS14380 (MTP23_14380) | - | 2876100..2876753 (+) | 654 | WP_029625649.1 | hypothetical protein | - |
| MTP23_RS14385 (MTP23_14385) | - | 2876806..2877333 (+) | 528 | WP_000771371.1 | spore coat protein | - |
| MTP23_RS14390 (MTP23_14390) | - | 2877465..2877677 (+) | 213 | WP_078065371.1 | pathogenicity island family protein | - |
| MTP23_RS14395 (MTP23_14395) | - | 2877674..2878243 (+) | 570 | WP_001293084.1 | terminase small subunit | - |
| MTP23_RS14400 (MTP23_14400) | - | 2878290..2878464 (+) | 175 | Protein_2808 | terminase small subunit | - |
| MTP23_RS14405 (MTP23_14405) | - | 2878630..2879643 (+) | 1014 | WP_029625650.1 | DUF6731 family protein | - |
| MTP23_RS14410 (MTP23_14410) | - | 2879656..2880123 (+) | 468 | WP_029625651.1 | hypothetical protein | - |
| MTP23_RS14415 (MTP23_14415) | - | 2880376..2880588 (+) | 213 | WP_031875240.1 | hypothetical protein | - |
| MTP23_RS14420 (MTP23_14420) | - | 2881140..2882054 (+) | 915 | WP_029625652.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| MTP23_RS14425 (MTP23_14425) | - | 2882112..2882960 (+) | 849 | WP_000824908.1 | class I SAM-dependent methyltransferase | - |
| MTP23_RS14430 (MTP23_14430) | - | 2883858..2885165 (-) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| MTP23_RS14435 (MTP23_14435) | - | 2885609..2886832 (-) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| MTP23_RS14440 (MTP23_14440) | lukH | 2887268..2888323 (+) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| MTP23_RS14445 (MTP23_14445) | lukG | 2888345..2889361 (+) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| MTP23_RS14450 (MTP23_14450) | sph | 2889599..2890429 (-) | 831 | Protein_2818 | sphingomyelin phosphodiesterase | - |
| MTP23_RS14455 (MTP23_14455) | - | 2890480..2891517 (-) | 1038 | WP_000857198.1 | site-specific integrase | - |
| MTP23_RS14460 (MTP23_14460) | - | 2891711..2892415 (-) | 705 | WP_000440838.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| MTP23_RS14465 (MTP23_14465) | - | 2892555..2892722 (-) | 168 | WP_000705241.1 | hypothetical protein | - |
| MTP23_RS14470 (MTP23_14470) | - | 2892792..2892977 (-) | 186 | WP_000109189.1 | hypothetical protein | - |
| MTP23_RS14475 (MTP23_14475) | - | 2892974..2893120 (-) | 147 | WP_000345949.1 | hypothetical protein | - |
| MTP23_RS14480 (MTP23_14480) | - | 2893194..2894048 (-) | 855 | WP_001557601.1 | HIRAN domain-containing protein | - |
| MTP23_RS14485 (MTP23_14485) | - | 2894060..2894776 (-) | 717 | WP_001083975.1 | LexA family transcriptional regulator | - |
| MTP23_RS14490 (MTP23_14490) | - | 2894940..2895182 (+) | 243 | WP_000639923.1 | DUF739 family protein | - |
| MTP23_RS14495 (MTP23_14495) | - | 2895195..2895641 (+) | 447 | WP_000435349.1 | hypothetical protein | - |
| MTP23_RS14500 (MTP23_14500) | - | 2895656..2895796 (+) | 141 | WP_000939495.1 | hypothetical protein | - |
| MTP23_RS14505 (MTP23_14505) | - | 2895789..2895998 (-) | 210 | WP_000772137.1 | hypothetical protein | - |
| MTP23_RS14510 (MTP23_14510) | - | 2896055..2896804 (+) | 750 | WP_001148587.1 | phage antirepressor KilAC domain-containing protein | - |
| MTP23_RS14515 (MTP23_14515) | - | 2896820..2897017 (+) | 198 | WP_001148856.1 | hypothetical protein | - |
| MTP23_RS14520 (MTP23_14520) | - | 2897004..2897384 (-) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| MTP23_RS14525 (MTP23_14525) | - | 2897439..2897762 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| MTP23_RS14530 (MTP23_14530) | - | 2897759..2897920 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| MTP23_RS14535 (MTP23_14535) | - | 2898015..2898317 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| MTP23_RS14540 (MTP23_14540) | - | 2898322..2898582 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| MTP23_RS14545 (MTP23_14545) | - | 2898591..2898854 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| MTP23_RS14550 (MTP23_14550) | - | 2898863..2900806 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| MTP23_RS14555 (MTP23_14555) | - | 2900808..2901728 (+) | 921 | WP_000138478.1 | recombinase RecT | - |
| MTP23_RS14560 (MTP23_14560) | - | 2901809..2902426 (+) | 618 | WP_078065370.1 | MBL fold metallo-hydrolase | - |
| MTP23_RS14565 (MTP23_14565) | ssbA | 2902427..2902897 (+) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| MTP23_RS14570 (MTP23_14570) | - | 2902927..2903821 (+) | 895 | Protein_2842 | DnaD domain-containing protein | - |
| MTP23_RS14575 (MTP23_14575) | - | 2903828..2904046 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| MTP23_RS14580 (MTP23_14580) | - | 2904055..2904459 (+) | 405 | WP_000401979.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MTP23_RS14585 (MTP23_14585) | - | 2904472..2904843 (+) | 372 | WP_000101279.1 | SA1788 family PVL leukocidin-associated protein | - |
| MTP23_RS14590 (MTP23_14590) | - | 2904843..2905100 (+) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| MTP23_RS14595 (MTP23_14595) | - | 2905097..2905345 (+) | 249 | WP_000178987.1 | SAV1978 family virulence-associated passenger protein | - |
| MTP23_RS14600 (MTP23_14600) | - | 2905360..2905605 (+) | 246 | WP_001065108.1 | DUF1024 family protein | - |
| MTP23_RS14605 (MTP23_14605) | - | 2905602..2906138 (+) | 537 | WP_000185693.1 | dUTPase | - |
| MTP23_RS14610 (MTP23_14610) | - | 2906175..2906420 (+) | 246 | WP_001282071.1 | hypothetical protein | - |
| MTP23_RS14615 (MTP23_14615) | - | 2906417..2906623 (+) | 207 | WP_000195784.1 | DUF1381 domain-containing protein | - |
| MTP23_RS14620 (MTP23_14620) | - | 2906620..2906769 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| MTP23_RS14625 (MTP23_14625) | - | 2906769..2906969 (+) | 201 | WP_001557462.1 | DUF1514 family protein | - |
| MTP23_RS14630 (MTP23_14630) | - | 2906997..2907413 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| MTP23_RS14635 (MTP23_14635) | - | 2907645..2907944 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=669523 MTP23_RS14565 WP_000934759.1 2902427..2902897(+) (ssbA) [Staphylococcus aureus strain N10CSA27]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=669523 MTP23_RS14565 WP_000934759.1 2902427..2902897(+) (ssbA) [Staphylococcus aureus strain N10CSA27]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |