Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MTP23_RS06240 | Genome accession | NZ_CP094443 |
| Coordinates | 1226400..1226828 (-) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus aureus strain N10CSA27 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1186998..1236411 | 1226400..1226828 | within | 0 |
Gene organization within MGE regions
Location: 1186998..1236411
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTP23_RS05970 (MTP23_05970) | - | 1186998..1187825 (-) | 828 | WP_000927632.1 | sulfite exporter TauE/SafE family protein | - |
| MTP23_RS05975 (MTP23_05975) | - | 1187838..1188686 (-) | 849 | WP_000608129.1 | DUF72 domain-containing protein | - |
| MTP23_RS05980 (MTP23_05980) | - | 1188734..1188817 (-) | 84 | WP_016170465.1 | hypothetical protein | - |
| MTP23_RS05985 (MTP23_05985) | - | 1189071..1190138 (-) | 1068 | WP_000267259.1 | nitronate monooxygenase family protein | - |
| MTP23_RS05990 (MTP23_05990) | - | 1190152..1191192 (-) | 1041 | WP_000582326.1 | CNNM domain-containing protein | - |
| MTP23_RS05995 (MTP23_05995) | - | 1191557..1191871 (+) | 315 | WP_000274029.1 | hypothetical protein | - |
| MTP23_RS06000 (MTP23_06000) | - | 1191877..1192016 (-) | 140 | Protein_1158 | hypothetical protein | - |
| MTP23_RS06005 (MTP23_06005) | - | 1192692..1193048 (-) | 357 | WP_243616918.1 | PBECR4 domain-containing protein | - |
| MTP23_RS06010 (MTP23_06010) | - | 1193733..1195178 (-) | 1446 | WP_001148136.1 | SH3 domain-containing protein | - |
| MTP23_RS06015 (MTP23_06015) | - | 1195159..1195596 (-) | 438 | WP_000354132.1 | phage holin | - |
| MTP23_RS06020 (MTP23_06020) | - | 1195652..1196047 (-) | 396 | WP_031897665.1 | hypothetical protein | - |
| MTP23_RS06025 (MTP23_06025) | - | 1196053..1197225 (-) | 1173 | WP_217658509.1 | BppU family phage baseplate upper protein | - |
| MTP23_RS06030 (MTP23_06030) | - | 1197238..1199112 (-) | 1875 | WP_021286114.1 | glucosaminidase domain-containing protein | - |
| MTP23_RS06035 (MTP23_06035) | - | 1199249..1199548 (-) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| MTP23_RS06040 (MTP23_06040) | - | 1199589..1199762 (-) | 174 | WP_001790193.1 | XkdX family protein | - |
| MTP23_RS06045 (MTP23_06045) | - | 1199766..1200143 (-) | 378 | WP_000705907.1 | DUF2977 domain-containing protein | - |
| MTP23_RS06050 (MTP23_06050) | - | 1200143..1201966 (-) | 1824 | WP_153156953.1 | BppU family phage baseplate upper protein | - |
| MTP23_RS06055 (MTP23_06055) | - | 1201966..1203864 (-) | 1899 | WP_153156954.1 | hypothetical protein | - |
| MTP23_RS06060 (MTP23_06060) | - | 1203877..1205763 (-) | 1887 | WP_001144705.1 | SGNH/GDSL hydrolase family protein | - |
| MTP23_RS06065 (MTP23_06065) | - | 1205774..1206709 (-) | 936 | WP_031897669.1 | phage tail domain-containing protein | - |
| MTP23_RS06070 (MTP23_06070) | - | 1206724..1209693 (-) | 2970 | WP_243616919.1 | terminase | - |
| MTP23_RS06075 (MTP23_06075) | - | 1209696..1210037 (-) | 342 | WP_001580347.1 | hypothetical protein | - |
| MTP23_RS06080 (MTP23_06080) | - | 1210058..1210552 (-) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| MTP23_RS06085 (MTP23_06085) | - | 1210614..1211174 (-) | 561 | WP_000046067.1 | hypothetical protein | - |
| MTP23_RS06090 (MTP23_06090) | - | 1211161..1211598 (-) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| MTP23_RS06095 (MTP23_06095) | - | 1211611..1212024 (-) | 414 | WP_153156956.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MTP23_RS06100 (MTP23_06100) | - | 1212011..1212346 (-) | 336 | WP_000482986.1 | phage head closure protein | - |
| MTP23_RS06105 (MTP23_06105) | - | 1212339..1212653 (-) | 315 | WP_000338936.1 | phage head-tail connector protein | - |
| MTP23_RS06110 (MTP23_06110) | - | 1212653..1212979 (-) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| MTP23_RS06115 (MTP23_06115) | - | 1212996..1213820 (-) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| MTP23_RS06120 (MTP23_06120) | - | 1213841..1214437 (-) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| MTP23_RS06125 (MTP23_06125) | - | 1214535..1215515 (-) | 981 | WP_049886845.1 | phage head morphogenesis protein | - |
| MTP23_RS06130 (MTP23_06130) | - | 1215454..1216932 (-) | 1479 | WP_049886846.1 | phage portal protein | - |
| MTP23_RS06135 (MTP23_06135) | - | 1216886..1218094 (-) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| MTP23_RS06140 (MTP23_06140) | - | 1218087..1218581 (-) | 495 | WP_000594085.1 | terminase small subunit | - |
| MTP23_RS06145 (MTP23_06145) | - | 1218932..1219333 (-) | 402 | WP_000286968.1 | hypothetical protein | - |
| MTP23_RS14950 | - | 1219334..1219468 (-) | 135 | WP_318598231.1 | hypothetical protein | - |
| MTP23_RS06150 (MTP23_06150) | - | 1219445..1219549 (-) | 105 | Protein_1189 | hypothetical protein | - |
| MTP23_RS06155 (MTP23_06155) | - | 1219542..1219778 (-) | 237 | WP_000608278.1 | hypothetical protein | - |
| MTP23_RS06160 (MTP23_06160) | - | 1219771..1220058 (-) | 288 | WP_000195801.1 | DUF1381 domain-containing protein | - |
| MTP23_RS06165 (MTP23_06165) | - | 1220095..1220622 (-) | 528 | WP_107364916.1 | dUTPase | - |
| MTP23_RS06170 (MTP23_06170) | - | 1220637..1220798 (-) | 162 | WP_000889683.1 | hypothetical protein | - |
| MTP23_RS06175 (MTP23_06175) | - | 1220799..1221080 (-) | 282 | WP_000454994.1 | hypothetical protein | - |
| MTP23_RS06180 (MTP23_06180) | - | 1221081..1221254 (-) | 174 | WP_000028424.1 | hypothetical protein | - |
| MTP23_RS06185 (MTP23_06185) | - | 1221244..1221495 (-) | 252 | WP_025174939.1 | DUF1024 family protein | - |
| MTP23_RS06190 (MTP23_06190) | - | 1221510..1221758 (-) | 249 | WP_031903705.1 | phi PVL orf 51-like protein | - |
| MTP23_RS06195 (MTP23_06195) | - | 1221759..1222130 (-) | 372 | WP_001140289.1 | SA1788 family PVL leukocidin-associated protein | - |
| MTP23_RS06200 (MTP23_06200) | - | 1222131..1222316 (-) | 186 | WP_001187242.1 | DUF3113 family protein | - |
| MTP23_RS06205 (MTP23_06205) | - | 1222321..1222725 (-) | 405 | WP_000049784.1 | DUF1064 domain-containing protein | - |
| MTP23_RS06210 (MTP23_06210) | - | 1222736..1222957 (-) | 222 | WP_001123673.1 | DUF3269 family protein | - |
| MTP23_RS06215 (MTP23_06215) | - | 1222970..1223131 (-) | 162 | WP_000237153.1 | hypothetical protein | - |
| MTP23_RS06220 (MTP23_06220) | - | 1223125..1223904 (-) | 780 | WP_000803065.1 | ATP-binding protein | - |
| MTP23_RS06225 (MTP23_06225) | - | 1223914..1224684 (-) | 771 | WP_000190224.1 | conserved phage C-terminal domain-containing protein | - |
| MTP23_RS06230 (MTP23_06230) | - | 1224749..1225606 (+) | 858 | WP_000371250.1 | DUF4393 domain-containing protein | - |
| MTP23_RS06235 (MTP23_06235) | - | 1225712..1226386 (-) | 675 | WP_243616920.1 | putative HNHc nuclease | - |
| MTP23_RS06240 (MTP23_06240) | ssbA | 1226400..1226828 (-) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| MTP23_RS06245 (MTP23_06245) | - | 1226828..1227451 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| MTP23_RS06250 (MTP23_06250) | - | 1227444..1227665 (-) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| MTP23_RS06255 (MTP23_06255) | - | 1227675..1227935 (-) | 261 | WP_243616921.1 | DUF1108 family protein | - |
| MTP23_RS06260 (MTP23_06260) | - | 1228029..1228190 (-) | 162 | WP_000048124.1 | DUF1270 family protein | - |
| MTP23_RS06265 (MTP23_06265) | - | 1228183..1228404 (-) | 222 | WP_000594790.1 | hypothetical protein | - |
| MTP23_RS06270 (MTP23_06270) | - | 1228418..1228867 (-) | 450 | WP_001094940.1 | hypothetical protein | - |
| MTP23_RS06275 (MTP23_06275) | - | 1228923..1229132 (+) | 210 | WP_000033736.1 | hypothetical protein | - |
| MTP23_RS06280 (MTP23_06280) | - | 1229121..1229291 (-) | 171 | WP_000398751.1 | hypothetical protein | - |
| MTP23_RS06285 (MTP23_06285) | - | 1229362..1230129 (-) | 768 | WP_000282677.1 | DUF6551 family protein | - |
| MTP23_RS06290 (MTP23_06290) | - | 1230122..1231003 (-) | 882 | WP_243616922.1 | ParB N-terminal domain-containing protein | - |
| MTP23_RS06295 (MTP23_06295) | - | 1231043..1231252 (-) | 210 | WP_001113664.1 | helix-turn-helix transcriptional regulator | - |
| MTP23_RS06300 (MTP23_06300) | - | 1231415..1231741 (+) | 327 | WP_000455972.1 | helix-turn-helix transcriptional regulator | - |
| MTP23_RS06305 (MTP23_06305) | - | 1231763..1232221 (+) | 459 | WP_024937215.1 | hypothetical protein | - |
| MTP23_RS06310 (MTP23_06310) | - | 1232239..1232964 (+) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| MTP23_RS06315 (MTP23_06315) | - | 1232996..1233700 (+) | 705 | WP_017804779.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| MTP23_RS06320 (MTP23_06320) | - | 1233897..1234946 (+) | 1050 | WP_001145730.1 | tyrosine-type recombinase/integrase | - |
| MTP23_RS06325 (MTP23_06325) | sufB | 1235014..1236411 (-) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=669506 MTP23_RS06240 WP_000934385.1 1226400..1226828(-) (ssbA) [Staphylococcus aureus strain N10CSA27]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=669506 MTP23_RS06240 WP_000934385.1 1226400..1226828(-) (ssbA) [Staphylococcus aureus strain N10CSA27]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |