Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | MRS49_RS01690 | Genome accession | NZ_CP094294 |
| Coordinates | 346209..346382 (+) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain AP3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 341209..351382
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MRS49_RS01675 | gcvT | 342023..343123 (-) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MRS49_RS01680 | - | 343546..345216 (+) | 1671 | WP_032874031.1 | SNF2-related protein | - |
| MRS49_RS01685 | - | 345238..346032 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| MRS49_RS01690 | sinI | 346209..346382 (+) | 174 | WP_032874029.1 | anti-repressor SinI family protein | Regulator |
| MRS49_RS01695 | sinR | 346416..346751 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| MRS49_RS01700 | - | 346799..347584 (-) | 786 | WP_032874027.1 | TasA family protein | - |
| MRS49_RS01705 | - | 347649..348233 (-) | 585 | WP_032874025.1 | signal peptidase I | - |
| MRS49_RS01710 | tapA | 348205..348876 (-) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| MRS49_RS01715 | - | 349135..349464 (+) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| MRS49_RS01720 | - | 349505..349684 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| MRS49_RS01725 | comGG | 349741..350118 (-) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MRS49_RS01730 | comGF | 350119..350619 (-) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| MRS49_RS01735 | comGE | 350528..350842 (-) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| MRS49_RS01740 | comGD | 350826..351263 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=668628 MRS49_RS01690 WP_032874029.1 346209..346382(+) (sinI) [Bacillus velezensis strain AP3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=668628 MRS49_RS01690 WP_032874029.1 346209..346382(+) (sinI) [Bacillus velezensis strain AP3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |