Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   MRS49_RS01735 Genome accession   NZ_CP094294
Coordinates   350528..350842 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain AP3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 345528..355842
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MRS49_RS01690 sinI 346209..346382 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  MRS49_RS01695 sinR 346416..346751 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MRS49_RS01700 - 346799..347584 (-) 786 WP_032874027.1 TasA family protein -
  MRS49_RS01705 - 347649..348233 (-) 585 WP_032874025.1 signal peptidase I -
  MRS49_RS01710 tapA 348205..348876 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  MRS49_RS01715 - 349135..349464 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  MRS49_RS01720 - 349505..349684 (-) 180 WP_022552966.1 YqzE family protein -
  MRS49_RS01725 comGG 349741..350118 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  MRS49_RS01730 comGF 350119..350619 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  MRS49_RS01735 comGE 350528..350842 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  MRS49_RS01740 comGD 350826..351263 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  MRS49_RS01745 comGC 351253..351519 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  MRS49_RS01750 comGB 351566..352603 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  MRS49_RS01755 comGA 352590..353660 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  MRS49_RS01760 - 353857..354807 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=668631 MRS49_RS01735 WP_032874016.1 350528..350842(-) (comGE) [Bacillus velezensis strain AP3]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=668631 MRS49_RS01735 WP_032874016.1 350528..350842(-) (comGE) [Bacillus velezensis strain AP3]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment