Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG43_RS00705 Genome accession   NZ_CP094175
Coordinates   151763..151888 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe063     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 146763..156888
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG43_RS00680 (MPG43_00680) - 146825..149047 (+) 2223 WP_245030613.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG43_RS00685 (MPG43_00685) panD 149037..149387 (+) 351 WP_000142212.1 aspartate 1-decarboxylase -
  MPG43_RS00690 (MPG43_00690) - 149398..149691 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG43_RS00695 (MPG43_00695) - 149691..150686 (+) 996 WP_245031212.1 PDZ domain-containing protein -
  MPG43_RS00700 (MPG43_00700) comB6 150692..151747 (+) 1056 WP_245031213.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG43_RS00705 (MPG43_00705) comB7 151763..151888 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG43_RS00710 (MPG43_00710) comB8 151885..152628 (+) 744 WP_245030615.1 virB8 family protein Machinery gene
  MPG43_RS00715 (MPG43_00715) comB9 152628..153593 (+) 966 WP_245030617.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG43_RS00720 (MPG43_00720) comB10 153586..154722 (+) 1137 WP_245030629.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG43_RS00725 (MPG43_00725) - 154792..156204 (+) 1413 WP_245030631.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=668010 MPG43_RS00705 WP_001217874.1 151763..151888(+) (comB7) [Helicobacter pylori strain Hpfe063]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=668010 MPG43_RS00705 WP_001217874.1 151763..151888(+) (comB7) [Helicobacter pylori strain Hpfe063]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment