Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG20_RS00725 Genome accession   NZ_CP094171
Coordinates   149661..149786 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe0003     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 144661..154786
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG20_RS00700 (MPG20_00700) - 144727..146949 (+) 2223 WP_245074388.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG20_RS00705 (MPG20_00705) panD 146939..147292 (+) 354 WP_180670611.1 aspartate 1-decarboxylase -
  MPG20_RS00710 (MPG20_00710) - 147295..147588 (+) 294 WP_048944407.1 YbaB/EbfC family nucleoid-associated protein -
  MPG20_RS00715 (MPG20_00715) - 147588..148583 (+) 996 WP_245074876.1 PDZ domain-containing protein -
  MPG20_RS00720 (MPG20_00720) comB6 148590..149645 (+) 1056 WP_180608952.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG20_RS00725 (MPG20_00725) comB7 149661..149786 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG20_RS00730 (MPG20_00730) comB8 149783..150526 (+) 744 WP_245050849.1 virB8 family protein Machinery gene
  MPG20_RS00735 (MPG20_00735) comB9 150526..151488 (+) 963 WP_245074390.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG20_RS00740 (MPG20_00740) comB10 151481..152617 (+) 1137 WP_245074392.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG20_RS00745 (MPG20_00745) - 152683..154095 (+) 1413 WP_245074394.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667941 MPG20_RS00725 WP_001217874.1 149661..149786(+) (comB7) [Helicobacter pylori strain Hpfe0003]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667941 MPG20_RS00725 WP_001217874.1 149661..149786(+) (comB7) [Helicobacter pylori strain Hpfe0003]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment