Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG70_RS00685 Genome accession   NZ_CP094168
Coordinates   146551..146676 (+) Length   41 a.a.
NCBI ID   WP_180655811.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe0006     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 141551..151676
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG70_RS00660 (MPG70_00660) - 141613..143835 (+) 2223 WP_245062256.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG70_RS00665 (MPG70_00665) panD 143825..144175 (+) 351 WP_000142208.1 aspartate 1-decarboxylase -
  MPG70_RS00670 (MPG70_00670) - 144186..144479 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG70_RS00675 (MPG70_00675) - 144479..145474 (+) 996 WP_245062852.1 PDZ domain-containing protein -
  MPG70_RS00680 (MPG70_00680) comB6 145480..146535 (+) 1056 WP_245062258.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG70_RS00685 (MPG70_00685) comB7 146551..146676 (+) 126 WP_180655811.1 comB7 lipoprotein Machinery gene
  MPG70_RS00690 (MPG70_00690) comB8 146673..147416 (+) 744 WP_245062260.1 virB8 family protein Machinery gene
  MPG70_RS00695 (MPG70_00695) comB9 147416..148384 (+) 969 WP_245062262.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG70_RS00700 (MPG70_00700) comB10 148377..149513 (+) 1137 WP_245062264.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG70_RS00705 (MPG70_00705) - 149582..150994 (+) 1413 WP_245062266.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4768.80 Da        Isoelectric Point: 9.3278

>NTDB_id=667899 MPG70_RS00685 WP_180655811.1 146551..146676(+) (comB7) [Helicobacter pylori strain Hpfe0006]
MRIFFVIMGLVLFGCTSKVHEMKKSPCALHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667899 MPG70_RS00685 WP_180655811.1 146551..146676(+) (comB7) [Helicobacter pylori strain Hpfe0006]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCCTG
CGCATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854

Multiple sequence alignment