Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG04_RS00715 Genome accession   NZ_CP094161
Coordinates   149336..149461 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe0015     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 144336..154461
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG04_RS00690 (MPG04_00690) - 144398..146620 (+) 2223 WP_245044528.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG04_RS00695 (MPG04_00695) panD 146610..146960 (+) 351 WP_245044529.1 aspartate 1-decarboxylase -
  MPG04_RS00700 (MPG04_00700) - 146971..147264 (+) 294 WP_131128566.1 YbaB/EbfC family nucleoid-associated protein -
  MPG04_RS00705 (MPG04_00705) - 147264..148259 (+) 996 WP_245044999.1 PDZ domain-containing protein -
  MPG04_RS00710 (MPG04_00710) comB6 148265..149320 (+) 1056 WP_245044530.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG04_RS00715 (MPG04_00715) comB7 149336..149461 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG04_RS00720 (MPG04_00720) comB8 149458..150201 (+) 744 WP_000660524.1 virB8 family protein Machinery gene
  MPG04_RS00725 (MPG04_00725) comB9 150201..151163 (+) 963 WP_245044532.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG04_RS00730 (MPG04_00730) comB10 151156..152292 (+) 1137 WP_245044533.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG04_RS00735 (MPG04_00735) - 152363..153778 (+) 1416 WP_245044534.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667811 MPG04_RS00715 WP_001217874.1 149336..149461(+) (comB7) [Helicobacter pylori strain Hpfe0015]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667811 MPG04_RS00715 WP_001217874.1 149336..149461(+) (comB7) [Helicobacter pylori strain Hpfe0015]
ATGAGAATCTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment