Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPF98_RS00720 Genome accession   NZ_CP094153
Coordinates   149740..149865 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe010     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 144740..154865
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF98_RS00695 (MPF98_00695) - 144800..147022 (+) 2223 WP_245049436.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF98_RS00700 (MPF98_00700) panD 147012..147362 (+) 351 WP_245049438.1 aspartate 1-decarboxylase -
  MPF98_RS00705 (MPF98_00705) - 147373..147666 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPF98_RS00710 (MPF98_00710) - 147666..148661 (+) 996 WP_245049992.1 PDZ domain-containing protein -
  MPF98_RS00715 (MPF98_00715) comB6 148669..149724 (+) 1056 WP_245049440.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF98_RS00720 (MPF98_00720) comB7 149740..149865 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPF98_RS00725 (MPF98_00725) comB8 149862..150605 (+) 744 WP_060760673.1 virB8 family protein Machinery gene
  MPF98_RS00730 (MPF98_00730) comB9 150605..151570 (+) 966 WP_245049442.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF98_RS00735 (MPF98_00735) comB10 151563..152699 (+) 1137 WP_245049444.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF98_RS00740 (MPF98_00740) - 152769..154181 (+) 1413 WP_245049446.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667703 MPF98_RS00720 WP_001217874.1 149740..149865(+) (comB7) [Helicobacter pylori strain Hpfe010]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667703 MPF98_RS00720 WP_001217874.1 149740..149865(+) (comB7) [Helicobacter pylori strain Hpfe010]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment