Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG81_RS00720 Genome accession   NZ_CP094151
Coordinates   156140..156265 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe019     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 151140..161265
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG81_RS00695 (MPG81_00695) - 151205..153424 (+) 2220 WP_245087262.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG81_RS00700 (MPG81_00700) panD 153414..153764 (+) 351 WP_245087265.1 aspartate 1-decarboxylase -
  MPG81_RS00705 (MPG81_00705) - 153775..154068 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG81_RS00710 (MPG81_00710) - 154068..155063 (+) 996 WP_245088312.1 PDZ domain-containing protein -
  MPG81_RS00715 (MPG81_00715) comB6 155069..156124 (+) 1056 WP_180589278.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG81_RS00720 (MPG81_00720) comB7 156140..156265 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG81_RS00725 (MPG81_00725) comB8 156262..157005 (+) 744 WP_245087269.1 virB8 family protein Machinery gene
  MPG81_RS00730 (MPG81_00730) comB9 157005..157967 (+) 963 WP_245087272.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG81_RS00735 (MPG81_00735) comB10 157960..159096 (+) 1137 WP_245087274.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG81_RS00740 (MPG81_00740) - 159166..160578 (+) 1413 WP_245087277.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667680 MPG81_RS00720 WP_001217874.1 156140..156265(+) (comB7) [Helicobacter pylori strain Hpfe019]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667680 MPG81_RS00720 WP_001217874.1 156140..156265(+) (comB7) [Helicobacter pylori strain Hpfe019]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment