Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG09_RS00710 Genome accession   NZ_CP094150
Coordinates   152082..152207 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe022     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 147082..157207
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG09_RS00685 (MPG09_00685) - 147142..149364 (+) 2223 WP_245027255.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG09_RS00690 (MPG09_00690) panD 149354..149704 (+) 351 WP_000142213.1 aspartate 1-decarboxylase -
  MPG09_RS00695 (MPG09_00695) - 149715..150008 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG09_RS00700 (MPG09_00700) - 150008..151003 (+) 996 WP_245027753.1 PDZ domain-containing protein -
  MPG09_RS00705 (MPG09_00705) comB6 151011..152066 (+) 1056 WP_245027257.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG09_RS00710 (MPG09_00710) comB7 152082..152207 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG09_RS00715 (MPG09_00715) comB8 152204..152941 (+) 738 WP_245027259.1 virB8 family protein Machinery gene
  MPG09_RS00720 (MPG09_00720) comB9 152941..153903 (+) 963 WP_245027261.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG09_RS00725 (MPG09_00725) comB10 153896..155032 (+) 1137 WP_245027263.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG09_RS00730 (MPG09_00730) - 155102..156514 (+) 1413 WP_245027265.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667656 MPG09_RS00710 WP_001217874.1 152082..152207(+) (comB7) [Helicobacter pylori strain Hpfe022]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667656 MPG09_RS00710 WP_001217874.1 152082..152207(+) (comB7) [Helicobacter pylori strain Hpfe022]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment