Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG13_RS00705 Genome accession   NZ_CP094137
Coordinates   148354..148479 (+) Length   41 a.a.
NCBI ID   WP_180508795.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe038     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 143354..153479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG13_RS00680 (MPG13_00680) - 143416..145638 (+) 2223 WP_245083560.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG13_RS00685 (MPG13_00685) panD 145628..145978 (+) 351 WP_180602206.1 aspartate 1-decarboxylase -
  MPG13_RS00690 (MPG13_00690) - 145989..146282 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG13_RS00695 (MPG13_00695) - 146282..147277 (+) 996 WP_180602221.1 PDZ domain-containing protein -
  MPG13_RS00700 (MPG13_00700) comB6 147283..148338 (+) 1056 WP_245083569.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG13_RS00705 (MPG13_00705) comB7 148354..148479 (+) 126 WP_180508795.1 comB7 lipoprotein Machinery gene
  MPG13_RS00710 (MPG13_00710) comB8 148476..149219 (+) 744 WP_000660524.1 virB8 family protein Machinery gene
  MPG13_RS00715 (MPG13_00715) comB9 149219..150181 (+) 963 WP_180602210.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG13_RS00720 (MPG13_00720) comB10 150174..151310 (+) 1137 WP_245083571.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG13_RS00725 (MPG13_00725) - 151380..152792 (+) 1413 WP_245083578.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4799.81 Da        Isoelectric Point: 8.5446

>NTDB_id=667426 MPG13_RS00705 WP_180508795.1 148354..148479(+) (comB7) [Helicobacter pylori strain Hpfe038]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLDLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667426 MPG13_RS00705 WP_180508795.1 148354..148479(+) (comB7) [Helicobacter pylori strain Hpfe038]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAGATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854

Multiple sequence alignment