Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG28_RS00715 Genome accession   NZ_CP094135
Coordinates   150877..151002 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe040     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 145877..156002
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG28_RS00690 (MPG28_00690) - 145939..148161 (+) 2223 WP_245078459.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG28_RS00695 (MPG28_00695) panD 148151..148501 (+) 351 WP_245078461.1 aspartate 1-decarboxylase -
  MPG28_RS00700 (MPG28_00700) - 148512..148805 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG28_RS00705 (MPG28_00705) - 148805..149800 (+) 996 WP_245078463.1 PDZ domain-containing protein -
  MPG28_RS00710 (MPG28_00710) comB6 149806..150861 (+) 1056 WP_245079204.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG28_RS00715 (MPG28_00715) comB7 150877..151002 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG28_RS00720 (MPG28_00720) comB8 150999..151742 (+) 744 WP_000660529.1 virB8 family protein Machinery gene
  MPG28_RS00725 (MPG28_00725) comB9 151742..152707 (+) 966 WP_245078465.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG28_RS00730 (MPG28_00730) comB10 152700..153836 (+) 1137 WP_245078467.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG28_RS00735 (MPG28_00735) - 153902..155314 (+) 1413 WP_245078470.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667383 MPG28_RS00715 WP_001217874.1 150877..151002(+) (comB7) [Helicobacter pylori strain Hpfe040]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667383 MPG28_RS00715 WP_001217874.1 150877..151002(+) (comB7) [Helicobacter pylori strain Hpfe040]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCCTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment