Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG21_RS00695 Genome accession   NZ_CP094133
Coordinates   147651..147776 (+) Length   41 a.a.
NCBI ID   WP_024117273.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe049     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 142651..152776
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG21_RS00670 (MPG21_00670) - 142713..144935 (+) 2223 WP_245025469.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG21_RS00675 (MPG21_00675) panD 144925..145275 (+) 351 WP_096470438.1 aspartate 1-decarboxylase -
  MPG21_RS00680 (MPG21_00680) - 145286..145579 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPG21_RS00685 (MPG21_00685) - 145579..146574 (+) 996 WP_245025473.1 PDZ domain-containing protein -
  MPG21_RS00690 (MPG21_00690) comB6 146580..147635 (+) 1056 WP_245026025.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG21_RS00695 (MPG21_00695) comB7 147651..147776 (+) 126 WP_024117273.1 hypothetical protein Machinery gene
  MPG21_RS00700 (MPG21_00700) comB8 147773..148516 (+) 744 WP_000660524.1 virB8 family protein Machinery gene
  MPG21_RS00705 (MPG21_00705) comB9 148516..149478 (+) 963 WP_245025477.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG21_RS00710 (MPG21_00710) comB10 149471..150607 (+) 1137 WP_245025479.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG21_RS00715 (MPG21_00715) - 150677..152089 (+) 1413 WP_245025481.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4752.75 Da        Isoelectric Point: 9.3278

>NTDB_id=667339 MPG21_RS00695 WP_024117273.1 147651..147776(+) (comB7) [Helicobacter pylori strain Hpfe049]
MRIFSVIMGLILFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667339 MPG21_RS00695 WP_024117273.1 147651..147776(+) (comB7) [Helicobacter pylori strain Hpfe049]
ATGAGAATTTTTTCTGTCATTATGGGACTAATATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAATTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

82.927

100

0.829

Multiple sequence alignment