Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG30_RS00725 Genome accession   NZ_CP094131
Coordinates   153936..154061 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe052     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 148936..159061
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG30_RS00700 (MPG30_00700) - 149001..151223 (+) 2223 WP_245047877.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG30_RS00705 (MPG30_00705) panD 151213..151566 (+) 354 WP_021307646.1 aspartate 1-decarboxylase -
  MPG30_RS00710 (MPG30_00710) - 151569..151862 (+) 294 WP_131128566.1 YbaB/EbfC family nucleoid-associated protein -
  MPG30_RS00715 (MPG30_00715) - 151862..152857 (+) 996 WP_245048345.1 PDZ domain-containing protein -
  MPG30_RS00720 (MPG30_00720) comB6 152865..153920 (+) 1056 WP_231192655.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG30_RS00725 (MPG30_00725) comB7 153936..154061 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG30_RS00730 (MPG30_00730) comB8 154058..154795 (+) 738 WP_058337650.1 virB8 family protein Machinery gene
  MPG30_RS00735 (MPG30_00735) comB9 154795..155754 (+) 960 WP_245047879.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG30_RS00740 (MPG30_00740) comB10 155747..156883 (+) 1137 WP_245047881.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG30_RS00745 (MPG30_00745) - 156953..158365 (+) 1413 WP_245047883.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667298 MPG30_RS00725 WP_001217874.1 153936..154061(+) (comB7) [Helicobacter pylori strain Hpfe052]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667298 MPG30_RS00725 WP_001217874.1 153936..154061(+) (comB7) [Helicobacter pylori strain Hpfe052]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment