Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG73_RS00745 Genome accession   NZ_CP094122
Coordinates   151898..152023 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe058     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 146898..157023
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG73_RS00720 (MPG73_00720) - 146958..149180 (+) 2223 WP_245057205.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG73_RS00725 (MPG73_00725) panD 149170..149520 (+) 351 WP_245057207.1 aspartate 1-decarboxylase -
  MPG73_RS00730 (MPG73_00730) - 149531..149824 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  MPG73_RS00735 (MPG73_00735) - 149824..150819 (+) 996 WP_245057857.1 PDZ domain-containing protein -
  MPG73_RS00740 (MPG73_00740) comB6 150827..151882 (+) 1056 WP_245057209.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG73_RS00745 (MPG73_00745) comB7 151898..152023 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG73_RS00750 (MPG73_00750) comB8 152020..152763 (+) 744 WP_000660522.1 virB8 family protein Machinery gene
  MPG73_RS00755 (MPG73_00755) comB9 152763..153725 (+) 963 WP_245057211.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG73_RS00760 (MPG73_00760) comB10 153718..154854 (+) 1137 WP_245057212.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG73_RS00765 (MPG73_00765) - 154924..156336 (+) 1413 WP_245057214.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667167 MPG73_RS00745 WP_001217874.1 151898..152023(+) (comB7) [Helicobacter pylori strain Hpfe058]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667167 MPG73_RS00745 WP_001217874.1 151898..152023(+) (comB7) [Helicobacter pylori strain Hpfe058]
ATGAGAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment