Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG07_RS00700 Genome accession   NZ_CP094116
Coordinates   148326..148451 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe066     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 143326..153451
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG07_RS00675 (MPG07_00675) - 143388..145610 (+) 2223 WP_245045829.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG07_RS00680 (MPG07_00680) panD 145600..145950 (+) 351 WP_000142269.1 aspartate 1-decarboxylase -
  MPG07_RS00685 (MPG07_00685) - 145961..146254 (+) 294 WP_245045831.1 YbaB/EbfC family nucleoid-associated protein -
  MPG07_RS00690 (MPG07_00690) - 146254..147249 (+) 996 WP_245046589.1 PDZ domain-containing protein -
  MPG07_RS00695 (MPG07_00695) comB6 147255..148310 (+) 1056 WP_245045833.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG07_RS00700 (MPG07_00700) comB7 148326..148451 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG07_RS00705 (MPG07_00705) comB8 148448..149191 (+) 744 WP_245045834.1 virB8 family protein Machinery gene
  MPG07_RS00710 (MPG07_00710) comB9 149191..150156 (+) 966 WP_245045836.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG07_RS00715 (MPG07_00715) comB10 150149..151285 (+) 1137 WP_245045845.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG07_RS00720 (MPG07_00720) - 151352..152764 (+) 1413 WP_245045847.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=667066 MPG07_RS00700 WP_001217874.1 148326..148451(+) (comB7) [Helicobacter pylori strain Hpfe066]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=667066 MPG07_RS00700 WP_001217874.1 148326..148451(+) (comB7) [Helicobacter pylori strain Hpfe066]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment