Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG17_RS00725 Genome accession   NZ_CP094107
Coordinates   153778..153903 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe074     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 148778..158903
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG17_RS00700 (MPG17_00700) - 148845..151067 (+) 2223 WP_245017946.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG17_RS00705 (MPG17_00705) panD 151057..151410 (+) 354 WP_245017947.1 aspartate 1-decarboxylase -
  MPG17_RS00710 (MPG17_00710) - 151413..151706 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG17_RS00715 (MPG17_00715) - 151706..152701 (+) 996 WP_245018274.1 PDZ domain-containing protein -
  MPG17_RS00720 (MPG17_00720) comB6 152707..153762 (+) 1056 WP_245018275.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG17_RS00725 (MPG17_00725) comB7 153778..153903 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG17_RS00730 (MPG17_00730) comB8 153900..154643 (+) 744 WP_120935466.1 virB8 family protein Machinery gene
  MPG17_RS00735 (MPG17_00735) comB9 154643..155608 (+) 966 WP_245017948.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG17_RS00740 (MPG17_00740) comB10 155601..156737 (+) 1137 WP_245017949.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG17_RS00745 (MPG17_00745) - 156803..158215 (+) 1413 WP_245017950.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=666934 MPG17_RS00725 WP_001217874.1 153778..153903(+) (comB7) [Helicobacter pylori strain Hpfe074]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666934 MPG17_RS00725 WP_001217874.1 153778..153903(+) (comB7) [Helicobacter pylori strain Hpfe074]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878