Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPF92_RS00780 Genome accession   NZ_CP094106
Coordinates   176895..177020 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe075     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 171895..182020
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF92_RS00755 (MPF92_00755) - 171957..174179 (+) 2223 WP_245023939.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF92_RS00760 (MPF92_00760) panD 174169..174519 (+) 351 WP_025223382.1 aspartate 1-decarboxylase -
  MPF92_RS00765 (MPF92_00765) - 174530..174823 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPF92_RS00770 (MPF92_00770) - 174823..175818 (+) 996 WP_245024426.1 PDZ domain-containing protein -
  MPF92_RS00775 (MPF92_00775) comB6 175824..176879 (+) 1056 WP_245023940.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF92_RS00780 (MPF92_00780) comB7 176895..177020 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPF92_RS00785 (MPF92_00785) comB8 177017..177760 (+) 744 WP_245023941.1 virB8 family protein Machinery gene
  MPF92_RS00790 (MPF92_00790) comB9 177760..178722 (+) 963 WP_245023942.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF92_RS00795 (MPF92_00795) comB10 178715..179851 (+) 1137 WP_245023943.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF92_RS00800 (MPF92_00800) - 179921..181333 (+) 1413 WP_245023944.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=666912 MPF92_RS00780 WP_001217874.1 176895..177020(+) (comB7) [Helicobacter pylori strain Hpfe075]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666912 MPF92_RS00780 WP_001217874.1 176895..177020(+) (comB7) [Helicobacter pylori strain Hpfe075]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878