Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG19_RS00975 Genome accession   NZ_CP094094
Coordinates   211321..211446 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe084     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 206321..216446
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG19_RS00950 (MPG19_00950) - 206383..208605 (+) 2223 WP_245066383.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG19_RS00955 (MPG19_00955) panD 208595..208945 (+) 351 WP_000142212.1 aspartate 1-decarboxylase -
  MPG19_RS00960 (MPG19_00960) - 208956..209249 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  MPG19_RS00965 (MPG19_00965) - 209249..210244 (+) 996 WP_245067050.1 PDZ domain-containing protein -
  MPG19_RS00970 (MPG19_00970) comB6 210250..211305 (+) 1056 WP_245066385.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG19_RS00975 (MPG19_00975) comB7 211321..211446 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPG19_RS00980 (MPG19_00980) comB8 211443..212186 (+) 744 WP_120935466.1 virB8 family protein Machinery gene
  MPG19_RS00985 (MPG19_00985) comB9 212186..213148 (+) 963 WP_245066387.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG19_RS00990 (MPG19_00990) comB10 213141..214277 (+) 1137 WP_245066389.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG19_RS00995 (MPG19_00995) - 214347..215759 (+) 1413 WP_245066391.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=666749 MPG19_RS00975 WP_001217874.1 211321..211446(+) (comB7) [Helicobacter pylori strain Hpfe084]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666749 MPG19_RS00975 WP_001217874.1 211321..211446(+) (comB7) [Helicobacter pylori strain Hpfe084]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878