Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPG05_RS00705 Genome accession   NZ_CP094079
Coordinates   148889..149014 (+) Length   41 a.a.
NCBI ID   WP_140483961.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe100     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 143889..154014
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG05_RS00680 (MPG05_00680) - 143954..146176 (+) 2223 WP_245070623.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG05_RS00685 (MPG05_00685) panD 146166..146519 (+) 354 WP_220984364.1 aspartate 1-decarboxylase -
  MPG05_RS00690 (MPG05_00690) - 146522..146815 (+) 294 WP_048944407.1 YbaB/EbfC family nucleoid-associated protein -
  MPG05_RS00695 (MPG05_00695) - 146815..147810 (+) 996 WP_180401319.1 PDZ domain-containing protein -
  MPG05_RS00700 (MPG05_00700) comB6 147818..148873 (+) 1056 WP_245071208.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG05_RS00705 (MPG05_00705) comB7 148889..149014 (+) 126 WP_140483961.1 comB7 lipoprotein Machinery gene
  MPG05_RS00710 (MPG05_00710) comB8 149011..149748 (+) 738 WP_120836407.1 virB8 family protein Machinery gene
  MPG05_RS00715 (MPG05_00715) comB9 149748..150716 (+) 969 WP_245070625.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG05_RS00720 (MPG05_00720) comB10 150709..151845 (+) 1137 WP_245070627.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG05_RS00725 (MPG05_00725) - 151911..153323 (+) 1413 WP_245070629.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4770.78 Da        Isoelectric Point: 9.3278

>NTDB_id=666517 MPG05_RS00705 WP_140483961.1 148889..149014(+) (comB7) [Helicobacter pylori strain Hpfe100]
MRIFSVIMGIMLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666517 MPG05_RS00705 WP_140483961.1 148889..149014(+) (comB7) [Helicobacter pylori strain Hpfe100]
ATGAGAATTTTTTCTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

80.488

100

0.805