Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG46_RS00730 Genome accession   NZ_CP094066
Coordinates   154220..154333 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori strain Hpfe110     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 149220..159333
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG46_RS00705 (MPG46_00705) - 149280..151502 (+) 2223 WP_245014457.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG46_RS00710 (MPG46_00710) panD 151492..151842 (+) 351 WP_000142215.1 aspartate 1-decarboxylase -
  MPG46_RS00715 (MPG46_00715) - 151853..152146 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  MPG46_RS00720 (MPG46_00720) - 152146..153141 (+) 996 WP_245014458.1 PDZ domain-containing protein -
  MPG46_RS00725 (MPG46_00725) comB6 153149..154204 (+) 1056 WP_245014788.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG46_RS00730 (MPG46_00730) comB7 154220..154333 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  MPG46_RS00735 (MPG46_00735) comB8 154330..155073 (+) 744 WP_058338730.1 virB8 family protein Machinery gene
  MPG46_RS00740 (MPG46_00740) comB9 155073..156038 (+) 966 WP_245014459.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG46_RS00745 (MPG46_00745) comB10 156031..157167 (+) 1137 WP_245014460.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG46_RS00750 (MPG46_00750) - 157238..158650 (+) 1413 WP_245014461.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=666347 MPG46_RS00730 WP_001217877.1 154220..154333(+) (comB7) [Helicobacter pylori strain Hpfe110]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=666347 MPG46_RS00730 WP_001217877.1 154220..154333(+) (comB7) [Helicobacter pylori strain Hpfe110]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACGAGCAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1A9H2U2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973