Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   MPF94_RS00710 Genome accession   NZ_CP094065
Coordinates   153642..153767 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain Hpfe112     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 148642..158767
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPF94_RS00685 (MPF94_00685) - 148701..150923 (+) 2223 WP_245022204.1 ATP-dependent Clp protease ATP-binding subunit -
  MPF94_RS00690 (MPF94_00690) panD 150913..151263 (+) 351 WP_154437088.1 aspartate 1-decarboxylase -
  MPF94_RS00695 (MPF94_00695) - 151274..151567 (+) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  MPF94_RS00700 (MPF94_00700) - 151567..152562 (+) 996 WP_245022536.1 PDZ domain-containing protein -
  MPF94_RS00705 (MPF94_00705) comB6 152568..153626 (+) 1059 WP_245022205.1 P-type conjugative transfer protein TrbL Machinery gene
  MPF94_RS00710 (MPF94_00710) comB7 153642..153767 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  MPF94_RS00715 (MPF94_00715) comB8 153764..154507 (+) 744 WP_000660533.1 virB8 family protein Machinery gene
  MPF94_RS00720 (MPF94_00720) comB9 154507..155469 (+) 963 WP_245022206.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPF94_RS00725 (MPF94_00725) comB10 155462..156598 (+) 1137 WP_245022207.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPF94_RS00730 (MPF94_00730) - 156668..158080 (+) 1413 WP_245022208.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=666326 MPF94_RS00710 WP_001217874.1 153642..153767(+) (comB7) [Helicobacter pylori strain Hpfe112]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=666326 MPF94_RS00710 WP_001217874.1 153642..153767(+) (comB7) [Helicobacter pylori strain Hpfe112]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878