Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   MOW04_RS12520 Genome accession   NZ_CP093546
Coordinates   2434896..2435279 (-) Length   127 a.a.
NCBI ID   WP_046160582.1    Uniprot ID   A0AA96UKP5
Organism   Bacillus sp. K1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2429896..2440279
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MOW04_RS12480 sinI 2430829..2431002 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MOW04_RS12485 sinR 2431036..2431371 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MOW04_RS12490 tasA 2431464..2432249 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  MOW04_RS12495 - 2432313..2432885 (-) 573 WP_003230181.1 signal peptidase I -
  MOW04_RS12500 tapA 2432869..2433630 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  MOW04_RS12505 - 2433902..2434228 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MOW04_RS12510 - 2434270..2434449 (-) 180 WP_029726723.1 YqzE family protein -
  MOW04_RS12515 comGG 2434521..2434895 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MOW04_RS12520 comGF 2434896..2435279 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  MOW04_RS12525 comGE 2435305..2435652 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene
  MOW04_RS12530 comGD 2435636..2436067 (-) 432 WP_046381179.1 comG operon protein ComGD Machinery gene
  MOW04_RS12535 comGC 2436057..2436353 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  MOW04_RS12540 comGB 2436367..2437404 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  MOW04_RS12545 comGA 2437391..2438461 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  MOW04_RS12550 - 2438673..2438870 (-) 198 WP_014480259.1 CBS domain-containing protein -
  MOW04_RS12555 corA 2438872..2439825 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14306.38 Da        Isoelectric Point: 5.5289

>NTDB_id=665149 MOW04_RS12520 WP_046160582.1 2434896..2435279(-) (comGF) [Bacillus sp. K1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYQSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=665149 MOW04_RS12520 WP_046160582.1 2434896..2435279(-) (comGF) [Bacillus sp. K1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCAATCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984