Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MOW04_RS12480 Genome accession   NZ_CP093546
Coordinates   2430829..2431002 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. K1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2425829..2436002
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MOW04_RS12465 gcvT 2426628..2427716 (-) 1089 WP_163130630.1 glycine cleavage system aminomethyltransferase GcvT -
  MOW04_RS12470 - 2428158..2429831 (+) 1674 WP_047182869.1 SNF2-related protein -
  MOW04_RS12475 - 2429852..2430646 (+) 795 WP_076458108.1 YqhG family protein -
  MOW04_RS12480 sinI 2430829..2431002 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MOW04_RS12485 sinR 2431036..2431371 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MOW04_RS12490 tasA 2431464..2432249 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  MOW04_RS12495 - 2432313..2432885 (-) 573 WP_003230181.1 signal peptidase I -
  MOW04_RS12500 tapA 2432869..2433630 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  MOW04_RS12505 - 2433902..2434228 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MOW04_RS12510 - 2434270..2434449 (-) 180 WP_029726723.1 YqzE family protein -
  MOW04_RS12515 comGG 2434521..2434895 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MOW04_RS12520 comGF 2434896..2435279 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  MOW04_RS12525 comGE 2435305..2435652 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=665146 MOW04_RS12480 WP_003230187.1 2430829..2431002(+) (sinI) [Bacillus sp. K1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=665146 MOW04_RS12480 WP_003230187.1 2430829..2431002(+) (sinI) [Bacillus sp. K1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1