Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MOE34_RS08730 | Genome accession | NZ_CP093528 |
| Coordinates | 1699196..1699729 (+) | Length | 177 a.a. |
| NCBI ID | WP_242222946.1 | Uniprot ID | - |
| Organism | Shinella zoogloeoides strain XJ20 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1697110..1750687 | 1699196..1699729 | within | 0 |
Gene organization within MGE regions
Location: 1697110..1750687
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MOE34_RS08730 | ssb | 1699196..1699729 (+) | 534 | WP_242222946.1 | single-stranded DNA-binding protein | Machinery gene |
| MOE34_RS08735 | - | 1700208..1701311 (+) | 1104 | WP_242218839.1 | site-specific integrase | - |
| MOE34_RS08740 | - | 1701308..1702828 (+) | 1521 | WP_242218837.1 | site-specific integrase | - |
| MOE34_RS08745 | - | 1702825..1704948 (+) | 2124 | WP_242218835.1 | hypothetical protein | - |
| MOE34_RS08750 | - | 1704952..1705374 (+) | 423 | WP_242218833.1 | hypothetical protein | - |
| MOE34_RS08755 | - | 1705371..1705763 (+) | 393 | WP_242218831.1 | hypothetical protein | - |
| MOE34_RS08760 | - | 1705769..1707640 (+) | 1872 | WP_242223857.1 | AAA family ATPase | - |
| MOE34_RS08765 | - | 1708116..1708583 (-) | 468 | WP_242218829.1 | helix-turn-helix transcriptional regulator | - |
| MOE34_RS08770 | - | 1709146..1711254 (+) | 2109 | WP_242218827.1 | AAA family ATPase | - |
| MOE34_RS08775 | - | 1711757..1712037 (+) | 281 | Protein_1721 | hypothetical protein | - |
| MOE34_RS08780 | - | 1712086..1712319 (+) | 234 | WP_242218825.1 | hypothetical protein | - |
| MOE34_RS08785 | - | 1712818..1714173 (+) | 1356 | WP_242218824.1 | class I SAM-dependent DNA methyltransferase | - |
| MOE34_RS08790 | - | 1714160..1714393 (+) | 234 | WP_108523402.1 | DUF6429 family protein | - |
| MOE34_RS08795 | - | 1714374..1716074 (-) | 1701 | WP_242218822.1 | IS66 family transposase | - |
| MOE34_RS08800 | tnpB | 1716120..1716458 (-) | 339 | WP_080579326.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| MOE34_RS08805 | - | 1716470..1716787 (-) | 318 | WP_347342742.1 | transposase | - |
| MOE34_RS08810 | - | 1716719..1717312 (+) | 594 | WP_242218820.1 | N-6 DNA methylase | - |
| MOE34_RS08815 | - | 1717302..1718522 (+) | 1221 | WP_242218817.1 | restriction endonuclease subunit S | - |
| MOE34_RS08820 | - | 1718519..1719070 (+) | 552 | WP_242218815.1 | hypothetical protein | - |
| MOE34_RS08825 | - | 1719074..1719769 (+) | 696 | WP_242218813.1 | abortive infection family protein | - |
| MOE34_RS08830 | - | 1719911..1723045 (+) | 3135 | WP_242218811.1 | type I restriction endonuclease subunit R | - |
| MOE34_RS08835 | - | 1723286..1723813 (-) | 528 | WP_242218810.1 | hypothetical protein | - |
| MOE34_RS08840 | - | 1724458..1726743 (+) | 2286 | WP_242218808.1 | hypothetical protein | - |
| MOE34_RS08845 | - | 1726731..1727900 (+) | 1170 | WP_242218806.1 | hypothetical protein | - |
| MOE34_RS08850 | - | 1727969..1729264 (+) | 1296 | WP_242218804.1 | hypothetical protein | - |
| MOE34_RS08855 | - | 1729596..1730015 (+) | 420 | WP_242222948.1 | cupin domain-containing protein | - |
| MOE34_RS08860 | - | 1730005..1730634 (-) | 630 | WP_242222950.1 | MarC family protein | - |
| MOE34_RS08865 | gyrA | 1730872..1733652 (+) | 2781 | WP_242222952.1 | DNA gyrase subunit A | - |
| MOE34_RS08870 | - | 1733829..1733975 (-) | 147 | WP_242222954.1 | hypothetical protein | - |
| MOE34_RS25430 | - | 1733989..1734114 (-) | 126 | WP_277955661.1 | hypothetical protein | - |
| MOE34_RS08875 | coaD | 1734365..1734859 (+) | 495 | WP_242222956.1 | pantetheine-phosphate adenylyltransferase | - |
| MOE34_RS08880 | - | 1734891..1735457 (+) | 567 | WP_242222958.1 | peptidylprolyl isomerase | - |
| MOE34_RS08885 | - | 1735539..1736054 (+) | 516 | WP_242222960.1 | peptidylprolyl isomerase | - |
| MOE34_RS08890 | - | 1736130..1736579 (+) | 450 | WP_242222962.1 | DMT family transporter | - |
| MOE34_RS08895 | queA | 1736588..1737655 (+) | 1068 | WP_242222964.1 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | - |
| MOE34_RS08900 | tgt | 1737652..1738782 (+) | 1131 | WP_242222966.1 | tRNA guanosine(34) transglycosylase Tgt | - |
| MOE34_RS08905 | - | 1738789..1739202 (-) | 414 | WP_242222968.1 | DUF4864 domain-containing protein | - |
| MOE34_RS08910 | - | 1739358..1739879 (-) | 522 | WP_242222970.1 | GNAT family N-acetyltransferase | - |
| MOE34_RS08915 | - | 1740186..1740662 (+) | 477 | WP_242222972.1 | Na+/H+ antiporter subunit E | - |
| MOE34_RS08920 | - | 1740655..1740915 (+) | 261 | WP_242222974.1 | monovalent cation/H+ antiporter complex subunit F | - |
| MOE34_RS08925 | - | 1740921..1741172 (+) | 252 | WP_242222976.1 | hydrogenase subunit MbhD domain-containing protein | - |
| MOE34_RS08930 | mnhG | 1741165..1741506 (+) | 342 | WP_242222977.1 | monovalent cation/H(+) antiporter subunit G | - |
| MOE34_RS08935 | mbhE | 1741503..1742201 (+) | 699 | WP_242222980.1 | hydrogen gas-evolving membrane-bound hydrogenase subunit E | - |
| MOE34_RS08940 | - | 1742288..1742587 (+) | 300 | WP_242222982.1 | sodium:proton antiporter | - |
| MOE34_RS08945 | - | 1742581..1745685 (+) | 3105 | WP_242222984.1 | proton-conducting transporter membrane subunit | - |
| MOE34_RS08950 | - | 1745799..1746809 (-) | 1011 | WP_242222985.1 | IS30 family transposase | - |
| MOE34_RS08955 | - | 1747045..1747989 (+) | 945 | WP_242223861.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| MOE34_RS08960 | - | 1747977..1748804 (-) | 828 | WP_242222987.1 | MBL fold metallo-hydrolase | - |
| MOE34_RS08965 | - | 1748807..1749586 (-) | 780 | WP_242222989.1 | TatD family hydrolase | - |
Sequence
Protein
Download Length: 177 a.a. Molecular weight: 18953.75 Da Isoelectric Point: 5.9703
>NTDB_id=665044 MOE34_RS08730 WP_242222946.1 1699196..1699729(+) (ssb) [Shinella zoogloeoides strain XJ20]
MAGSVNKVILIGNVGADPEIRRTQDGRPIANLRIATSETWRDRNNGERREKTEWHNVVVFNEGLCKVVEQYVKKGAKLYI
EGALQTRKWQDQTGNDRYSTEIVLQGFNSTLTMLDGRGEGGGERRGGGDFGGSSNYGGGAPSYDDYGSRPASGGGGGGGS
RSGGGSMARDMDDDIPF
MAGSVNKVILIGNVGADPEIRRTQDGRPIANLRIATSETWRDRNNGERREKTEWHNVVVFNEGLCKVVEQYVKKGAKLYI
EGALQTRKWQDQTGNDRYSTEIVLQGFNSTLTMLDGRGEGGGERRGGGDFGGSSNYGGGAPSYDDYGSRPASGGGGGGGS
RSGGGSMARDMDDDIPF
Nucleotide
Download Length: 534 bp
>NTDB_id=665044 MOE34_RS08730 WP_242222946.1 1699196..1699729(+) (ssb) [Shinella zoogloeoides strain XJ20]
ATGGCTGGAAGCGTCAACAAGGTGATCTTGATCGGGAATGTCGGGGCGGACCCGGAAATCCGCCGGACGCAGGACGGCCG
GCCGATCGCCAACCTGCGCATCGCGACGTCCGAGACCTGGCGCGACCGCAACAACGGCGAGCGTCGCGAGAAGACGGAAT
GGCACAATGTCGTCGTTTTCAACGAAGGTCTGTGCAAGGTCGTCGAGCAATATGTGAAGAAGGGCGCCAAGCTCTATATC
GAGGGCGCGCTGCAGACCCGCAAGTGGCAGGACCAGACCGGCAACGACCGCTATTCGACGGAAATCGTGCTGCAGGGCTT
CAACTCGACGCTCACCATGCTGGACGGTCGCGGTGAAGGCGGCGGCGAGCGCCGCGGCGGCGGCGATTTCGGCGGCAGCA
GCAACTATGGCGGCGGCGCGCCGAGCTACGACGACTACGGTTCGCGTCCGGCTTCTGGCGGTGGCGGCGGCGGCGGCAGC
CGTTCGGGCGGCGGTTCGATGGCCCGCGACATGGATGACGACATTCCGTTCTAG
ATGGCTGGAAGCGTCAACAAGGTGATCTTGATCGGGAATGTCGGGGCGGACCCGGAAATCCGCCGGACGCAGGACGGCCG
GCCGATCGCCAACCTGCGCATCGCGACGTCCGAGACCTGGCGCGACCGCAACAACGGCGAGCGTCGCGAGAAGACGGAAT
GGCACAATGTCGTCGTTTTCAACGAAGGTCTGTGCAAGGTCGTCGAGCAATATGTGAAGAAGGGCGCCAAGCTCTATATC
GAGGGCGCGCTGCAGACCCGCAAGTGGCAGGACCAGACCGGCAACGACCGCTATTCGACGGAAATCGTGCTGCAGGGCTT
CAACTCGACGCTCACCATGCTGGACGGTCGCGGTGAAGGCGGCGGCGAGCGCCGCGGCGGCGGCGATTTCGGCGGCAGCA
GCAACTATGGCGGCGGCGCGCCGAGCTACGACGACTACGGTTCGCGTCCGGCTTCTGGCGGTGGCGGCGGCGGCGGCAGC
CGTTCGGGCGGCGGTTCGATGGCCCGCGACATGGATGACGACATTCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
44.33 |
100 |
0.486 |
| ssb | Vibrio cholerae strain A1552 |
47.977 |
97.74 |
0.469 |
| ssb | Neisseria meningitidis MC58 |
37.297 |
100 |
0.39 |
| ssb | Neisseria gonorrhoeae MS11 |
37.297 |
100 |
0.39 |