Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MPF55_RS03915 | Genome accession | NZ_CP093527 |
| Coordinates | 784418..784888 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934772.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 697R | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 766415..826743 | 784418..784888 | within | 0 |
Gene organization within MGE regions
Location: 766415..826743
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MPF55_RS03730 (MPF55_03730) | - | 766415..766969 (+) | 555 | WP_000132890.1 | alpha/beta hydrolase | - |
| MPF55_RS03775 (MPF55_03775) | - | 768743..768953 (-) | 211 | Protein_697 | hypothetical protein | - |
| MPF55_RS03780 (MPF55_03780) | - | 769414..770202 (-) | 789 | WP_000206347.1 | DUF1829 domain-containing protein | - |
| MPF55_RS03785 (MPF55_03785) | - | 770239..770505 (-) | 267 | Protein_699 | hypothetical protein | - |
| MPF55_RS03790 (MPF55_03790) | istA | 770596..771887 (+) | 1292 | Protein_700 | IS21 family transposase | - |
| MPF55_RS03795 (MPF55_03795) | - | 771880..771978 (+) | 99 | Protein_701 | IS21-like element ISCbo2 family helper ATPase IstB | - |
| MPF55_RS03800 (MPF55_03800) | - | 772032..772316 (+) | 285 | WP_000134547.1 | hypothetical protein | - |
| MPF55_RS03805 (MPF55_03805) | - | 772544..773581 (-) | 1038 | WP_000857191.1 | site-specific integrase | - |
| MPF55_RS03810 (MPF55_03810) | - | 773640..774104 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| MPF55_RS03815 (MPF55_03815) | - | 774204..774386 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| MPF55_RS03820 (MPF55_03820) | - | 774590..774931 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| MPF55_RS03825 (MPF55_03825) | - | 774937..775869 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| MPF55_RS03830 (MPF55_03830) | - | 775885..776598 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| MPF55_RS03835 (MPF55_03835) | - | 776561..776734 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| MPF55_RS03840 (MPF55_03840) | - | 776731..776994 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| MPF55_RS03845 (MPF55_03845) | - | 777010..777225 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| MPF55_RS03850 (MPF55_03850) | - | 777214..777543 (-) | 330 | WP_000180411.1 | hypothetical protein | - |
| MPF55_RS03855 (MPF55_03855) | - | 777594..778346 (+) | 753 | WP_113556758.1 | phage antirepressor KilAC domain-containing protein | - |
| MPF55_RS03860 (MPF55_03860) | - | 778362..778559 (+) | 198 | WP_001148861.1 | hypothetical protein | - |
| MPF55_RS03865 (MPF55_03865) | - | 778590..778730 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| MPF55_RS03870 (MPF55_03870) | - | 778745..779377 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| MPF55_RS03875 (MPF55_03875) | - | 779436..779756 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| MPF55_RS03880 (MPF55_03880) | - | 779753..779914 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| MPF55_RS03885 (MPF55_03885) | - | 780006..780308 (+) | 303 | WP_044131919.1 | DUF2482 family protein | - |
| MPF55_RS03890 (MPF55_03890) | - | 780313..780573 (+) | 261 | WP_072456798.1 | DUF1108 family protein | - |
| MPF55_RS03895 (MPF55_03895) | - | 780582..780845 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| MPF55_RS03900 (MPF55_03900) | - | 780854..782797 (+) | 1944 | WP_044557032.1 | AAA family ATPase | - |
| MPF55_RS03905 (MPF55_03905) | - | 782799..783719 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| MPF55_RS03910 (MPF55_03910) | - | 783800..784417 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| MPF55_RS03915 (MPF55_03915) | ssbA | 784418..784888 (+) | 471 | WP_000934772.1 | single-stranded DNA-binding protein | Machinery gene |
| MPF55_RS03920 (MPF55_03920) | - | 784918..785811 (+) | 894 | WP_031770227.1 | DnaD domain-containing protein | - |
| MPF55_RS03925 (MPF55_03925) | - | 785818..786036 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| MPF55_RS03930 (MPF55_03930) | - | 786045..786500 (+) | 456 | WP_000401965.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MPF55_RS03935 (MPF55_03935) | - | 786513..786881 (+) | 369 | WP_000101275.1 | SA1788 family PVL leukocidin-associated protein | - |
| MPF55_RS03940 (MPF55_03940) | - | 786885..787127 (+) | 243 | WP_000131384.1 | SAV1978 family virulence-associated passenger protein | - |
| MPF55_RS03945 (MPF55_03945) | - | 787141..787389 (+) | 249 | WP_001065072.1 | DUF1024 family protein | - |
| MPF55_RS03950 (MPF55_03950) | - | 787382..787918 (+) | 537 | WP_000185680.1 | dUTPase | - |
| MPF55_RS03955 (MPF55_03955) | - | 787955..788200 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| MPF55_RS03960 (MPF55_03960) | - | 788197..788403 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| MPF55_RS03965 (MPF55_03965) | - | 788400..788786 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| MPF55_RS03970 (MPF55_03970) | - | 788783..788932 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| MPF55_RS03975 (MPF55_03975) | - | 788932..789132 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| MPF55_RS03980 (MPF55_03980) | - | 789160..789576 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| MPF55_RS03985 (MPF55_03985) | - | 789808..790107 (+) | 300 | WP_000988330.1 | HNH endonuclease | - |
| MPF55_RS03990 (MPF55_03990) | - | 790237..790581 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| MPF55_RS03995 (MPF55_03995) | - | 790578..792239 (+) | 1662 | WP_031901050.1 | terminase large subunit | - |
| MPF55_RS04000 (MPF55_04000) | - | 792255..793442 (+) | 1188 | WP_113556760.1 | phage portal protein | - |
| MPF55_RS04005 (MPF55_04005) | - | 793426..794163 (+) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| MPF55_RS04010 (MPF55_04010) | - | 794187..795332 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| MPF55_RS04015 (MPF55_04015) | - | 795352..795636 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| MPF55_RS04020 (MPF55_04020) | - | 795626..795910 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| MPF55_RS04025 (MPF55_04025) | - | 795894..796256 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| MPF55_RS04030 (MPF55_04030) | - | 796253..796657 (+) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| MPF55_RS04035 (MPF55_04035) | - | 796654..797061 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| MPF55_RS04040 (MPF55_04040) | - | 797062..797706 (+) | 645 | WP_044557008.1 | major tail protein | - |
| MPF55_RS04045 (MPF55_04045) | - | 797742..797972 (+) | 231 | Protein_751 | Ig-like domain-containing protein | - |
| MPF55_RS04050 (MPF55_04050) | - | 798022..798372 (+) | 351 | WP_001096355.1 | hypothetical protein | - |
| MPF55_RS13755 | - | 798426..798560 (+) | 135 | WP_000364140.1 | hypothetical protein | - |
| MPF55_RS04055 (MPF55_04055) | - | 798617..803161 (+) | 4545 | WP_113588360.1 | phage tail tape measure protein | - |
| MPF55_RS04060 (MPF55_04060) | - | 803158..804642 (+) | 1485 | WP_044557002.1 | phage tail domain-containing protein | - |
| MPF55_RS04065 (MPF55_04065) | - | 804658..808443 (+) | 3786 | WP_044557000.1 | phage tail spike protein | - |
| MPF55_RS04070 (MPF55_04070) | - | 808433..808585 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| MPF55_RS04075 (MPF55_04075) | - | 808632..808919 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| MPF55_RS04080 (MPF55_04080) | - | 808977..809273 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| MPF55_RS04085 (MPF55_04085) | pepG1 | 809465..809599 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| MPF55_RS04090 (MPF55_04090) | - | 809652..809759 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| MPF55_RS04095 (MPF55_04095) | - | 809811..810065 (+) | 255 | WP_000611512.1 | phage holin | - |
| MPF55_RS04100 (MPF55_04100) | - | 810077..810832 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| MPF55_RS04105 (MPF55_04105) | sak | 811023..811514 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| MPF55_RS04110 (MPF55_04110) | - | 812164..812499 (+) | 336 | Protein_765 | SH3 domain-containing protein | - |
| MPF55_RS04115 (MPF55_04115) | - | 812594..813043 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| MPF55_RS04120 (MPF55_04120) | scn | 813728..814078 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| MPF55_RS04125 (MPF55_04125) | - | 814131..814391 (-) | 261 | WP_001791826.1 | hypothetical protein | - |
| MPF55_RS13775 | - | 814370..814678 (-) | 309 | WP_001789576.1 | hypothetical protein | - |
| MPF55_RS04130 (MPF55_04130) | - | 814702..814881 (-) | 180 | WP_000669791.1 | hypothetical protein | - |
| MPF55_RS04135 (MPF55_04135) | - | 815286..815843 (+) | 558 | Protein_771 | restriction endonuclease subunit S | - |
| MPF55_RS04140 (MPF55_04140) | - | 816094..816948 (+) | 855 | WP_001044434.1 | M23 family metallopeptidase | - |
| MPF55_RS04145 (MPF55_04145) | - | 817008..818255 (-) | 1248 | Protein_773 | polysaccharide lyase family 8 super-sandwich domain-containing protein | - |
| MPF55_RS04150 (MPF55_04150) | - | 818429..819324 (+) | 896 | Protein_774 | tyrosine-type recombinase/integrase | - |
| MPF55_RS04155 (MPF55_04155) | - | 819823..821529 (+) | 1707 | WP_000533463.1 | UvrD-helicase domain-containing protein | - |
| MPF55_RS04160 (MPF55_04160) | - | 821539..822192 (+) | 654 | WP_000657815.1 | hypothetical protein | - |
| MPF55_RS04165 (MPF55_04165) | - | 822502..823074 (-) | 573 | WP_000414219.1 | hypothetical protein | - |
| MPF55_RS04170 (MPF55_04170) | - | 823175..823516 (-) | 342 | WP_000627534.1 | DUF3969 family protein | - |
| MPF55_RS04175 (MPF55_04175) | - | 823557..824183 (-) | 627 | WP_000669039.1 | hypothetical protein | - |
| MPF55_RS04180 (MPF55_04180) | - | 824259..825254 (-) | 996 | WP_000070638.1 | DUF4352 domain-containing protein | - |
| MPF55_RS04185 (MPF55_04185) | - | 825335..825985 (-) | 651 | WP_001838615.1 | excalibur calcium-binding domain-containing protein | - |
| MPF55_RS04190 (MPF55_04190) | - | 826288..826743 (+) | 456 | WP_168360851.1 | DUF4909 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17657.52 Da Isoelectric Point: 5.2672
>NTDB_id=665010 MPF55_RS03915 WP_000934772.1 784418..784888(+) (ssbA) [Staphylococcus aureus strain 697R]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=665010 MPF55_RS03915 WP_000934772.1 784418..784888(+) (ssbA) [Staphylococcus aureus strain 697R]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |