Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | MN088_RS11230 | Genome accession | NZ_CP093413 |
| Coordinates | 2205777..2206193 (-) | Length | 138 a.a. |
| NCBI ID | WP_021216554.1 | Uniprot ID | A0AAC9R430 |
| Organism | Lactococcus lactis strain AH1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2202506..2250247 | 2205777..2206193 | within | 0 |
Gene organization within MGE regions
Location: 2202506..2250247
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MN088_RS11200 (MN088_11200) | - | 2202506..2203243 (-) | 738 | WP_010906311.1 | metal ABC transporter ATP-binding protein | - |
| MN088_RS11205 (MN088_11205) | - | 2203420..2204262 (-) | 843 | WP_010906312.1 | metal ABC transporter substrate-binding protein | - |
| MN088_RS11210 (MN088_11210) | - | 2204259..2204696 (-) | 438 | WP_010906313.1 | zinc-dependent MarR family transcriptional regulator | - |
| MN088_RS11215 (MN088_11215) | comGG | 2204777..2205061 (-) | 285 | WP_010906314.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MN088_RS11220 (MN088_11220) | comGF | 2205100..2205546 (-) | 447 | WP_031296844.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| MN088_RS11225 (MN088_11225) | comGE | 2205509..2205805 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| MN088_RS11230 (MN088_11230) | comGD | 2205777..2206193 (-) | 417 | WP_021216554.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| MN088_RS11235 (MN088_11235) | comGC | 2206168..2206437 (-) | 270 | WP_023349160.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| MN088_RS11240 (MN088_11240) | - | 2206584..2207108 (-) | 525 | WP_014570795.1 | GNAT family N-acetyltransferase | - |
| MN088_RS11245 (MN088_11245) | - | 2207188..2207967 (-) | 780 | WP_242166666.1 | peptidoglycan amidohydrolase family protein | - |
| MN088_RS11250 (MN088_11250) | - | 2207967..2208254 (-) | 288 | WP_242166667.1 | phage holin | - |
| MN088_RS11255 (MN088_11255) | - | 2208268..2208492 (-) | 225 | WP_010905920.1 | hemolysin XhlA family protein | - |
| MN088_RS11260 (MN088_11260) | - | 2208505..2208726 (-) | 222 | WP_242166668.1 | hypothetical protein | - |
| MN088_RS11265 (MN088_11265) | - | 2208746..2213902 (-) | 5157 | WP_242166669.1 | interleukin-like EMT inducer domain-containing protein | - |
| MN088_RS11270 (MN088_11270) | - | 2213902..2215458 (-) | 1557 | WP_242166670.1 | distal tail protein Dit | - |
| MN088_RS11275 (MN088_11275) | - | 2215459..2218071 (-) | 2613 | WP_242166671.1 | phage tail tape measure protein | - |
| MN088_RS11280 (MN088_11280) | - | 2218061..2218768 (-) | 708 | WP_031561043.1 | Gp15 family bacteriophage protein | - |
| MN088_RS11285 (MN088_11285) | - | 2218784..2219191 (-) | 408 | WP_003131323.1 | hypothetical protein | - |
| MN088_RS11290 (MN088_11290) | - | 2219248..2219724 (-) | 477 | WP_014570559.1 | hypothetical protein | - |
| MN088_RS11295 (MN088_11295) | - | 2219735..2220169 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| MN088_RS11300 (MN088_11300) | - | 2220169..2220498 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| MN088_RS11305 (MN088_11305) | - | 2220495..2220839 (-) | 345 | WP_242166672.1 | putative minor capsid protein | - |
| MN088_RS11310 (MN088_11310) | - | 2220829..2221230 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| MN088_RS11315 (MN088_11315) | - | 2221304..2221540 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| MN088_RS11320 (MN088_11320) | - | 2221569..2222486 (-) | 918 | WP_242166673.1 | phage capsid protein | - |
| MN088_RS11325 (MN088_11325) | - | 2222501..2223562 (-) | 1062 | WP_242166674.1 | XkdF-like putative serine protease domain-containing protein | - |
| MN088_RS11330 (MN088_11330) | - | 2223578..2224408 (-) | 831 | WP_242166675.1 | phage minor head protein | - |
| MN088_RS11335 (MN088_11335) | - | 2224401..2225930 (-) | 1530 | WP_058221397.1 | phage portal protein | - |
| MN088_RS11340 (MN088_11340) | terL | 2225943..2227394 (-) | 1452 | WP_242166676.1 | phage terminase large subunit | - |
| MN088_RS11345 (MN088_11345) | - | 2227375..2227872 (-) | 498 | WP_014570801.1 | hypothetical protein | - |
| MN088_RS11350 (MN088_11350) | - | 2227901..2229058 (-) | 1158 | WP_242166677.1 | DNA modification methylase | - |
| MN088_RS11360 (MN088_11360) | - | 2229535..2229957 (-) | 423 | WP_242166678.1 | RinA family protein | - |
| MN088_RS11365 (MN088_11365) | - | 2230035..2230343 (-) | 309 | WP_242166679.1 | hypothetical protein | - |
| MN088_RS11370 (MN088_11370) | - | 2230504..2230647 (+) | 144 | WP_242166756.1 | hypothetical protein | - |
| MN088_RS11375 (MN088_11375) | - | 2230577..2230813 (-) | 237 | WP_015967998.1 | DUF1660 domain-containing protein | - |
| MN088_RS11380 (MN088_11380) | - | 2230810..2231028 (-) | 219 | WP_011834792.1 | hypothetical protein | - |
| MN088_RS11385 (MN088_11385) | - | 2231047..2231385 (-) | 339 | WP_242166680.1 | DUF1140 family protein | - |
| MN088_RS11390 (MN088_11390) | dut | 2231386..2231805 (-) | 420 | WP_242166681.1 | dUTP diphosphatase | - |
| MN088_RS11395 (MN088_11395) | - | 2231802..2232479 (-) | 678 | WP_242166682.1 | DUF1642 domain-containing protein | - |
| MN088_RS11400 (MN088_11400) | - | 2232451..2232810 (-) | 360 | WP_150890987.1 | hypothetical protein | - |
| MN088_RS11405 (MN088_11405) | - | 2233002..2233208 (-) | 207 | WP_242166683.1 | hypothetical protein | - |
| MN088_RS11410 (MN088_11410) | - | 2233319..2233558 (-) | 240 | WP_058225578.1 | DUF1031 family protein | - |
| MN088_RS11415 (MN088_11415) | - | 2233555..2233860 (-) | 306 | WP_242166684.1 | hypothetical protein | - |
| MN088_RS11420 (MN088_11420) | - | 2233865..2234253 (-) | 389 | Protein_2229 | RusA family crossover junction endodeoxyribonuclease | - |
| MN088_RS11425 (MN088_11425) | - | 2234266..2234508 (-) | 243 | WP_242166685.1 | L-rhamnose isomerase | - |
| MN088_RS11430 (MN088_11430) | - | 2234501..2235415 (-) | 915 | WP_242166686.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MN088_RS11435 (MN088_11435) | - | 2235679..2236605 (-) | 927 | WP_242166687.1 | RecT family recombinase | - |
| MN088_RS11440 (MN088_11440) | - | 2236602..2237435 (-) | 834 | WP_240819231.1 | hypothetical protein | - |
| MN088_RS11445 (MN088_11445) | - | 2237539..2237781 (-) | 243 | WP_023164375.1 | hypothetical protein | - |
| MN088_RS13565 | - | 2237794..2237916 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| MN088_RS11450 (MN088_11450) | - | 2237913..2238095 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| MN088_RS11455 (MN088_11455) | - | 2238111..2238800 (-) | 690 | WP_014570818.1 | phage regulatory protein | - |
| MN088_RS11460 (MN088_11460) | - | 2238859..2239092 (-) | 234 | WP_014570819.1 | transcriptional regulator | - |
| MN088_RS11465 (MN088_11465) | - | 2239299..2239679 (+) | 381 | WP_031561101.1 | XRE family transcriptional regulator | - |
| MN088_RS11470 (MN088_11470) | - | 2239690..2240274 (+) | 585 | WP_058221714.1 | hypothetical protein | - |
| MN088_RS11475 (MN088_11475) | - | 2240330..2240869 (+) | 540 | WP_023189015.1 | PH domain-containing protein | - |
| MN088_RS11480 (MN088_11480) | - | 2240989..2242446 (+) | 1458 | WP_031561103.1 | recombinase family protein | - |
| MN088_RS11485 (MN088_11485) | - | 2242443..2242583 (-) | 141 | WP_023164653.1 | hypothetical protein | - |
| MN088_RS11490 (MN088_11490) | comGB | 2242597..2243670 (-) | 1074 | WP_010906319.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| MN088_RS11495 (MN088_11495) | comGA | 2243564..2244502 (-) | 939 | WP_010906320.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| MN088_RS11500 (MN088_11500) | - | 2244622..2249538 (-) | 4917 | WP_031296849.1 | PolC-type DNA polymerase III | - |
| MN088_RS11505 (MN088_11505) | - | 2249711..2250247 (-) | 537 | WP_010906322.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15902.69 Da Isoelectric Point: 7.9826
>NTDB_id=664539 MN088_RS11230 WP_021216554.1 2205777..2206193(-) (comGD) [Lactococcus lactis strain AH1]
MKNEILMTKAFTLLESLLVLLIISFITTLFSLEIIQTIHLFKGELFVLQFENFYKRSQEDAALLQKSESLVAKNQELICE
DRSITIPKEVAVKDFTVKFDDKGENSSLQKLTISLPYEKKFITYQLEIGSGKFKKKIS
MKNEILMTKAFTLLESLLVLLIISFITTLFSLEIIQTIHLFKGELFVLQFENFYKRSQEDAALLQKSESLVAKNQELICE
DRSITIPKEVAVKDFTVKFDDKGENSSLQKLTISLPYEKKFITYQLEIGSGKFKKKIS
Nucleotide
Download Length: 417 bp
>NTDB_id=664539 MN088_RS11230 WP_021216554.1 2205777..2206193(-) (comGD) [Lactococcus lactis strain AH1]
ATGAAGAACGAAATTTTAATGACTAAAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGATTATTTCTTTTATCAC
AACTCTTTTTTCTTTAGAAATAATACAAACAATCCATCTTTTTAAGGGAGAATTGTTTGTTCTTCAATTTGAAAATTTCT
ATAAAAGGAGTCAAGAAGATGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAAGAATTAATCTGTGAA
GATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGATGATAAGGGAGAGAATTCTAG
CTTACAAAAACTCACAATTTCTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGAGATAGGCAGTGGAAAATTTA
AAAAGAAAATCAGTTAA
ATGAAGAACGAAATTTTAATGACTAAAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGATTATTTCTTTTATCAC
AACTCTTTTTTCTTTAGAAATAATACAAACAATCCATCTTTTTAAGGGAGAATTGTTTGTTCTTCAATTTGAAAATTTCT
ATAAAAGGAGTCAAGAAGATGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAAGAATTAATCTGTGAA
GATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGATGATAAGGGAGAGAATTCTAG
CTTACAAAAACTCACAATTTCTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGAGATAGGCAGTGGAAAATTTA
AAAAGAAAATCAGTTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
65.942 |
100 |
0.659 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
40.458 |
94.928 |
0.384 |
| comYD | Streptococcus mutans UA140 |
40.625 |
92.754 |
0.377 |
| comYD | Streptococcus mutans UA159 |
40.625 |
92.754 |
0.377 |