Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   MNG38_RS12620 Genome accession   NZ_CP093289
Coordinates   2456210..2456593 (-) Length   127 a.a.
NCBI ID   WP_015251713.1    Uniprot ID   -
Organism   Bacillus subtilis strain H2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2451210..2461593
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNG38_RS12580 (MNG38_12580) sinI 2452144..2452317 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  MNG38_RS12585 (MNG38_12585) sinR 2452351..2452686 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MNG38_RS12590 (MNG38_12590) tasA 2452779..2453564 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  MNG38_RS12595 (MNG38_12595) sipW 2453628..2454200 (-) 573 WP_003246088.1 signal peptidase I SipW -
  MNG38_RS12600 (MNG38_12600) tapA 2454184..2454945 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  MNG38_RS12605 (MNG38_12605) yqzG 2455217..2455543 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MNG38_RS12610 (MNG38_12610) spoIITA 2455585..2455764 (-) 180 WP_029726723.1 YqzE family protein -
  MNG38_RS12615 (MNG38_12615) comGG 2455835..2456209 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  MNG38_RS12620 (MNG38_12620) comGF 2456210..2456593 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  MNG38_RS12625 (MNG38_12625) comGE 2456619..2456966 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  MNG38_RS12630 (MNG38_12630) comGD 2456950..2457381 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  MNG38_RS12635 (MNG38_12635) comGC 2457371..2457667 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  MNG38_RS12640 (MNG38_12640) comGB 2457681..2458718 (-) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  MNG38_RS12645 (MNG38_12645) comGA 2458705..2459775 (-) 1071 WP_242139143.1 competence protein ComGA Machinery gene
  MNG38_RS12650 (MNG38_12650) - 2459988..2460185 (-) 198 WP_014480259.1 CBS domain-containing protein -
  MNG38_RS12655 (MNG38_12655) corA 2460187..2461140 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14280.43 Da        Isoelectric Point: 6.4838

>NTDB_id=662990 MNG38_RS12620 WP_015251713.1 2456210..2456593(-) (comGF) [Bacillus subtilis strain H2]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=662990 MNG38_RS12620 WP_015251713.1 2456210..2456593(-) (comGF) [Bacillus subtilis strain H2]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992