Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MNG38_RS12580 Genome accession   NZ_CP093289
Coordinates   2452144..2452317 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain H2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2447144..2457317
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNG38_RS12565 (MNG38_12565) gcvT 2447943..2449031 (-) 1089 WP_042976496.1 glycine cleavage system aminomethyltransferase GcvT -
  MNG38_RS12570 (MNG38_12570) hepAA 2449473..2451146 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  MNG38_RS12575 (MNG38_12575) yqhG 2451167..2451961 (+) 795 WP_003230200.1 YqhG family protein -
  MNG38_RS12580 (MNG38_12580) sinI 2452144..2452317 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  MNG38_RS12585 (MNG38_12585) sinR 2452351..2452686 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MNG38_RS12590 (MNG38_12590) tasA 2452779..2453564 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  MNG38_RS12595 (MNG38_12595) sipW 2453628..2454200 (-) 573 WP_003246088.1 signal peptidase I SipW -
  MNG38_RS12600 (MNG38_12600) tapA 2454184..2454945 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  MNG38_RS12605 (MNG38_12605) yqzG 2455217..2455543 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MNG38_RS12610 (MNG38_12610) spoIITA 2455585..2455764 (-) 180 WP_029726723.1 YqzE family protein -
  MNG38_RS12615 (MNG38_12615) comGG 2455835..2456209 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  MNG38_RS12620 (MNG38_12620) comGF 2456210..2456593 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  MNG38_RS12625 (MNG38_12625) comGE 2456619..2456966 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=662987 MNG38_RS12580 WP_003230187.1 2452144..2452317(+) (sinI) [Bacillus subtilis strain H2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=662987 MNG38_RS12580 WP_003230187.1 2452144..2452317(+) (sinI) [Bacillus subtilis strain H2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1