Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   ML603_RS08520 Genome accession   NZ_CP092887
Coordinates   1715173..1715664 (-) Length   163 a.a.
NCBI ID   WP_002993238.1    Uniprot ID   A0A9X5LZM9
Organism   Streptococcus dysgalactiae subsp. equisimilis strain Karl     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1660046..1715664 1715173..1715664 within 0


Gene organization within MGE regions


Location: 1660046..1715664
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ML603_RS08130 (ML603_08130) - 1660046..1660513 (-) 468 WP_111717547.1 deaminase -
  ML603_RS08135 (ML603_08135) - 1660547..1661620 (-) 1074 WP_143927916.1 Xaa-Pro peptidase family protein -
  ML603_RS08140 (ML603_08140) uvrA 1661715..1664543 (-) 2829 WP_241067048.1 excinuclease ABC subunit UvrA -
  ML603_RS08145 (ML603_08145) prx 1664772..1664954 (-) 183 WP_241067050.1 Paratox Regulator
  ML603_RS08150 (ML603_08150) - 1665123..1665599 (+) 477 WP_241067051.1 hypothetical protein -
  ML603_RS08155 (ML603_08155) - 1665612..1665995 (+) 384 WP_241067053.1 hypothetical protein -
  ML603_RS08160 (ML603_08160) - 1665979..1667235 (+) 1257 WP_241067055.1 DEAD/DEAH box helicase -
  ML603_RS08165 (ML603_08165) - 1667219..1668490 (+) 1272 WP_241067056.1 DUF3440 domain-containing protein -
  ML603_RS08170 (ML603_08170) - 1668474..1668989 (+) 516 WP_241067057.1 ParB/RepB/Spo0J family partition protein -
  ML603_RS08175 (ML603_08175) - 1669028..1669231 (+) 204 WP_241067058.1 hypothetical protein -
  ML603_RS08180 (ML603_08180) - 1669521..1669952 (+) 432 WP_241067059.1 hypothetical protein -
  ML603_RS08185 (ML603_08185) - 1669970..1670302 (+) 333 WP_241067060.1 hypothetical protein -
  ML603_RS08190 (ML603_08190) - 1670365..1671570 (-) 1206 WP_241067061.1 glucosaminidase domain-containing protein -
  ML603_RS08195 (ML603_08195) - 1671681..1671866 (-) 186 WP_155977143.1 holin -
  ML603_RS08200 (ML603_08200) - 1671870..1672136 (-) 267 WP_241067062.1 hypothetical protein -
  ML603_RS08205 (ML603_08205) - 1672147..1672830 (-) 684 WP_241067063.1 hypothetical protein -
  ML603_RS08210 (ML603_08210) - 1672833..1673264 (-) 432 WP_241066830.1 DUF1617 family protein -
  ML603_RS08215 (ML603_08215) - 1673277..1675163 (-) 1887 WP_241066831.1 gp58-like family protein -
  ML603_RS08220 (ML603_08220) - 1675174..1676034 (-) 861 WP_241066832.1 hypothetical protein -
  ML603_RS08225 (ML603_08225) - 1676979..1677146 (-) 168 Protein_1563 collagen-like protein -
  ML603_RS08230 (ML603_08230) - 1677146..1679197 (-) 2052 WP_241067064.1 phage tail spike protein -
  ML603_RS08235 (ML603_08235) - 1679194..1679973 (-) 780 WP_241067065.1 distal tail protein Dit -
  ML603_RS08240 (ML603_08240) - 1680005..1684024 (-) 4020 WP_241067066.1 tape measure protein -
  ML603_RS08245 (ML603_08245) - 1684039..1684368 (-) 330 WP_342370262.1 hypothetical protein -
  ML603_RS08250 (ML603_08250) - 1684410..1684769 (-) 360 WP_241067068.1 tail assembly chaperone -
  ML603_RS08255 (ML603_08255) - 1684832..1685344 (-) 513 WP_283776552.1 phage major tail protein, TP901-1 family -
  ML603_RS08260 (ML603_08260) - 1685441..1685830 (-) 390 WP_241067071.1 phage capsid protein -
  ML603_RS08265 (ML603_08265) - 1685827..1686192 (-) 366 WP_241067073.1 HK97-gp10 family putative phage morphogenesis protein -
  ML603_RS08270 (ML603_08270) - 1686173..1686481 (-) 309 WP_241067075.1 hypothetical protein -
  ML603_RS08275 (ML603_08275) - 1686478..1686831 (-) 354 WP_241067076.1 phage head-tail connector protein -
  ML603_RS08280 (ML603_08280) - 1686841..1687110 (-) 270 WP_241067078.1 HeH/LEM domain-containing protein -
  ML603_RS08285 (ML603_08285) - 1687122..1688171 (-) 1050 WP_241067079.1 major capsid protein -
  ML603_RS08290 (ML603_08290) - 1688174..1688554 (-) 381 WP_241067080.1 head decoration protein -
  ML603_RS08295 (ML603_08295) - 1688564..1689184 (-) 621 WP_241067081.1 DUF4355 domain-containing protein -
  ML603_RS08300 (ML603_08300) - 1689372..1689560 (-) 189 WP_241067082.1 hypothetical protein -
  ML603_RS08305 (ML603_08305) - 1689557..1689826 (-) 270 WP_241067083.1 hypothetical protein -
  ML603_RS08310 (ML603_08310) - 1689880..1690299 (-) 420 WP_003052396.1 HD domain-containing protein -
  ML603_RS08315 (ML603_08315) - 1690296..1690502 (-) 207 WP_003052398.1 hypothetical protein -
  ML603_RS08320 (ML603_08320) - 1690504..1692075 (-) 1572 WP_241067084.1 phage minor head protein -
  ML603_RS08325 (ML603_08325) - 1692056..1693555 (-) 1500 WP_241067085.1 phage portal protein -
  ML603_RS08330 (ML603_08330) - 1693567..1694856 (-) 1290 WP_241067086.1 PBSX family phage terminase large subunit -
  ML603_RS08335 (ML603_08335) - 1694846..1695196 (-) 351 WP_226317236.1 helix-turn-helix domain-containing protein -
  ML603_RS09900 - 1695258..1695386 (-) 129 WP_017647279.1 hypothetical protein -
  ML603_RS08340 (ML603_08340) - 1695794..1696231 (-) 438 WP_241067088.1 DUF1492 domain-containing protein -
  ML603_RS08345 (ML603_08345) - 1696683..1696889 (-) 207 WP_241067090.1 hypothetical protein -
  ML603_RS08350 (ML603_08350) - 1696886..1697431 (-) 546 WP_241067092.1 DUF1642 domain-containing protein -
  ML603_RS08355 (ML603_08355) - 1697524..1697754 (-) 231 WP_342370280.1 hypothetical protein -
  ML603_RS08360 (ML603_08360) - 1697793..1698206 (-) 414 WP_241067093.1 YopX family protein -
  ML603_RS08365 (ML603_08365) - 1698216..1698485 (-) 270 WP_241067095.1 hypothetical protein -
  ML603_RS09905 - 1698482..1698616 (-) 135 WP_268892750.1 hypothetical protein -
  ML603_RS08370 (ML603_08370) - 1698613..1698897 (-) 285 WP_241067096.1 DUF3310 domain-containing protein -
  ML603_RS09925 - 1698891..1699142 (-) 252 WP_342370263.1 hypothetical protein -
  ML603_RS08375 (ML603_08375) - 1699139..1699495 (-) 357 WP_241067097.1 hypothetical protein -
  ML603_RS08380 (ML603_08380) - 1699479..1699799 (-) 321 WP_241067098.1 VRR-NUC domain-containing protein -
  ML603_RS08385 (ML603_08385) - 1699796..1700209 (-) 414 WP_241067099.1 hypothetical protein -
  ML603_RS08390 (ML603_08390) - 1700471..1701946 (-) 1476 WP_241067100.1 DNA primase family protein -
  ML603_RS08395 (ML603_08395) - 1701936..1702748 (-) 813 WP_241067101.1 bifunctional DNA primase/polymerase -
  ML603_RS08400 (ML603_08400) - 1702752..1703210 (-) 459 WP_069107278.1 DUF669 domain-containing protein -
  ML603_RS08405 (ML603_08405) - 1703226..1704455 (-) 1230 WP_241067102.1 DEAD/DEAH box helicase -
  ML603_RS08410 (ML603_08410) - 1704557..1705249 (-) 693 WP_241067103.1 AAA family ATPase -
  ML603_RS08415 (ML603_08415) - 1705236..1705526 (-) 291 WP_241067104.1 hypothetical protein -
  ML603_RS08420 (ML603_08420) - 1705657..1705839 (-) 183 WP_155782749.1 hypothetical protein -
  ML603_RS08425 (ML603_08425) - 1705827..1706039 (-) 213 WP_241067105.1 hypothetical protein -
  ML603_RS08430 (ML603_08430) - 1706020..1706160 (-) 141 WP_012767409.1 hypothetical protein -
  ML603_RS08435 (ML603_08435) - 1706190..1706447 (-) 258 WP_001191791.1 hypothetical protein -
  ML603_RS08440 (ML603_08440) - 1706525..1706710 (-) 186 WP_021340658.1 helix-turn-helix transcriptional regulator -
  ML603_RS08445 (ML603_08445) - 1706854..1707075 (+) 222 WP_155977172.1 hypothetical protein -
  ML603_RS08450 (ML603_08450) - 1707072..1707416 (-) 345 WP_241067106.1 hypothetical protein -
  ML603_RS08455 (ML603_08455) - 1707436..1707642 (-) 207 WP_136301010.1 hypothetical protein -
  ML603_RS08460 (ML603_08460) - 1707792..1708007 (-) 216 WP_000164463.1 helix-turn-helix transcriptional regulator -
  ML603_RS08465 (ML603_08465) - 1708101..1708793 (+) 693 WP_241067107.1 DUF4145 domain-containing protein -
  ML603_RS08470 (ML603_08470) - 1708769..1708978 (-) 210 WP_241067116.1 hypothetical protein -
  ML603_RS08475 (ML603_08475) - 1709012..1709170 (-) 159 WP_241067118.1 hypothetical protein -
  ML603_RS08480 (ML603_08480) - 1709229..1709441 (+) 213 WP_226325425.1 hypothetical protein -
  ML603_RS08485 (ML603_08485) - 1709430..1709579 (-) 150 WP_241067119.1 hypothetical protein -
  ML603_RS08490 (ML603_08490) - 1709941..1710705 (+) 765 WP_241067121.1 helix-turn-helix transcriptional regulator -
  ML603_RS08495 (ML603_08495) - 1710743..1711423 (+) 681 WP_241067122.1 hypothetical protein -
  ML603_RS08500 (ML603_08500) - 1711549..1712703 (+) 1155 WP_241067123.1 site-specific integrase -
  ML603_RS08505 (ML603_08505) - 1712947..1713891 (+) 945 WP_129556234.1 magnesium transporter CorA family protein -
  ML603_RS08510 (ML603_08510) - 1714023..1714682 (+) 660 WP_138126468.1 DUF1129 domain-containing protein -
  ML603_RS08515 (ML603_08515) rpsR 1714816..1715055 (-) 240 WP_002983142.1 30S ribosomal protein S18 -
  ML603_RS08520 (ML603_08520) ssbA 1715173..1715664 (-) 492 WP_002993238.1 single-stranded DNA-binding protein Machinery gene

Sequence

Protein


Download         Length: 163 a.a.        Molecular weight: 17995.78 Da        Isoelectric Point: 4.8894

>NTDB_id=660947 ML603_RS08520 WP_002993238.1 1715173..1715664(-) (ssbA) [Streptococcus dysgalactiae subsp. equisimilis strain Karl]
MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRTFKSQNGEREADFINCVIWRQPAENLANWAKKGALIGITGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRATREGGSTGSFNGGFNNNTSSSNSYSAPAQQTPNFGRDDSPFGNSNPMDISDDD
LPF

Nucleotide


Download         Length: 492 bp        

>NTDB_id=660947 ML603_RS08520 WP_002993238.1 1715173..1715664(-) (ssbA) [Streptococcus dysgalactiae subsp. equisimilis strain Karl]
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGATGCAGAACTTCGTTACACACCAAGTCAAGTAGCTGTGGC
TACCTTCACACTTGCTGTTAACCGTACCTTTAAAAGCCAAAATGGTGAGCGCGAGGCAGATTTCATTAACTGTGTGATCT
GGCGCCAACCTGCTGAAAATTTAGCAAACTGGGCTAAAAAAGGTGCCTTAATCGGAATTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGCCGTGC
TACACGTGAAGGTGGCTCAACTGGCTCATTTAATGGTGGATTTAACAATAACACTTCATCATCGAACAGTTACTCAGCGC
CTGCACAACAAACACCTAACTTTGGAAGAGATGATAGCCCATTTGGCAATTCAAACCCGATGGATATCTCAGATGACGAT
CTTCCATTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

58.621

100

0.626
  ssb Latilactobacillus sakei subsp. sakei 23K

59.302

100

0.626
  ssbB Bacillus subtilis subsp. subtilis str. 168

56.604

65.031

0.368