Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   MK848_RS04600 Genome accession   NZ_CP092824
Coordinates   941080..941463 (-) Length   127 a.a.
NCBI ID   WP_015251713.1    Uniprot ID   -
Organism   Bacillus subtilis strain S1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 936080..946463
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MK848_RS04560 (MK848_04565) sinI 937014..937187 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  MK848_RS04565 (MK848_04570) sinR 937221..937556 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MK848_RS04570 (MK848_04575) tasA 937649..938434 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  MK848_RS04575 (MK848_04580) sipW 938498..939070 (-) 573 WP_003246088.1 signal peptidase I SipW -
  MK848_RS04580 (MK848_04585) tapA 939054..939815 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  MK848_RS04585 (MK848_04590) yqzG 940087..940413 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MK848_RS04590 (MK848_04595) spoIITA 940455..940634 (-) 180 WP_003230176.1 YqzE family protein -
  MK848_RS04595 (MK848_04600) comGG 940705..941079 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  MK848_RS04600 (MK848_04605) comGF 941080..941463 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  MK848_RS04605 (MK848_04610) comGE 941489..941836 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  MK848_RS04610 (MK848_04615) comGD 941820..942251 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  MK848_RS04615 (MK848_04620) comGC 942241..942537 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  MK848_RS04620 (MK848_04625) comGB 942551..943588 (-) 1038 WP_101172386.1 comG operon protein ComGB Machinery gene
  MK848_RS04625 (MK848_04630) comGA 943575..944645 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  MK848_RS04630 (MK848_04635) - 944858..945055 (-) 198 WP_029726717.1 hypothetical protein -
  MK848_RS04635 (MK848_04640) corA 945057..946010 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14280.43 Da        Isoelectric Point: 6.4838

>NTDB_id=660410 MK848_RS04600 WP_015251713.1 941080..941463(-) (comGF) [Bacillus subtilis strain S1]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=660410 MK848_RS04600 WP_015251713.1 941080..941463(-) (comGF) [Bacillus subtilis strain S1]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992