Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   MK616_RS12245 Genome accession   NZ_CP092778
Coordinates   2526945..2527382 (-) Length   145 a.a.
NCBI ID   WP_095061019.1    Uniprot ID   A0AAP4DGY0
Organism   Bacillus amyloliquefaciens strain WF2020     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2521945..2532382
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MK616_RS12195 (MK616_12195) sinI 2522328..2522501 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  MK616_RS12200 (MK616_12200) sinR 2522535..2522870 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MK616_RS12205 (MK616_12205) tasA 2522918..2523703 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  MK616_RS12210 (MK616_12210) sipW 2523768..2524352 (-) 585 WP_012117977.1 signal peptidase I SipW -
  MK616_RS12215 (MK616_12215) tapA 2524324..2524995 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  MK616_RS12220 (MK616_12220) - 2525254..2525583 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  MK616_RS12225 (MK616_12225) - 2525624..2525803 (-) 180 WP_003153093.1 YqzE family protein -
  MK616_RS12230 (MK616_12230) comGG 2525860..2526237 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  MK616_RS12235 (MK616_12235) comGF 2526238..2526633 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  MK616_RS12240 (MK616_12240) comGE 2526647..2526961 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  MK616_RS12245 (MK616_12245) comGD 2526945..2527382 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  MK616_RS12250 (MK616_12250) comGC 2527372..2527680 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  MK616_RS12255 (MK616_12255) comGB 2527685..2528722 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  MK616_RS12260 (MK616_12260) comGA 2528709..2529779 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  MK616_RS12265 (MK616_12265) - 2529972..2530922 (-) 951 WP_240680061.1 magnesium transporter CorA family protein -
  MK616_RS12270 (MK616_12270) - 2531068..2532369 (+) 1302 WP_029973873.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16282.81 Da        Isoelectric Point: 10.1850

>NTDB_id=660207 MK616_RS12245 WP_095061019.1 2526945..2527382(-) (comGD) [Bacillus amyloliquefaciens strain WF2020]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLVVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=660207 MK616_RS12245 WP_095061019.1 2526945..2527382(-) (comGD) [Bacillus amyloliquefaciens strain WF2020]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGTCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552