Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   MKF36_RS11750 Genome accession   NZ_CP092750
Coordinates   2407295..2407672 (-) Length   125 a.a.
NCBI ID   WP_032866434.1    Uniprot ID   -
Organism   Bacillus velezensis strain KS04AU     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2402295..2412672
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKF36_RS11710 (MKF36_11710) - 2402793..2403587 (+) 795 WP_007408330.1 YqhG family protein -
  MKF36_RS11715 (MKF36_11715) sinI 2403764..2403937 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  MKF36_RS11720 (MKF36_11720) sinR 2403971..2404306 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MKF36_RS11725 (MKF36_11725) - 2404354..2405139 (-) 786 WP_007408329.1 TasA family protein -
  MKF36_RS11730 (MKF36_11730) - 2405204..2405788 (-) 585 WP_007408328.1 signal peptidase I -
  MKF36_RS11735 (MKF36_11735) tapA 2405760..2406431 (-) 672 WP_042635356.1 amyloid fiber anchoring/assembly protein TapA -
  MKF36_RS11740 (MKF36_11740) - 2406690..2407019 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  MKF36_RS11745 (MKF36_11745) - 2407059..2407238 (-) 180 WP_003153093.1 YqzE family protein -
  MKF36_RS11750 (MKF36_11750) comGG 2407295..2407672 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  MKF36_RS11755 (MKF36_11755) comGF 2407673..2408173 (-) 501 WP_262982688.1 competence type IV pilus minor pilin ComGF -
  MKF36_RS11760 (MKF36_11760) comGE 2408082..2408396 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  MKF36_RS11765 (MKF36_11765) comGD 2408380..2408817 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  MKF36_RS11770 (MKF36_11770) comGC 2408807..2409073 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  MKF36_RS11775 (MKF36_11775) comGB 2409120..2410157 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  MKF36_RS11780 (MKF36_11780) comGA 2410144..2411214 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  MKF36_RS11785 (MKF36_11785) - 2411406..2412356 (-) 951 WP_032870601.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14197.08 Da        Isoelectric Point: 9.7381

>NTDB_id=660028 MKF36_RS11750 WP_032866434.1 2407295..2407672(-) (comGG) [Bacillus velezensis strain KS04AU]
MYKSDGFIYPAVLFVSAAVLLVISYTTSDFITRKTFAKEAGEYWTGENLLQNGALLSSRHMTQGQRVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=660028 MKF36_RS11750 WP_032866434.1 2407295..2407672(-) (comGG) [Bacillus velezensis strain KS04AU]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTAC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGACCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAGGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGGCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488